KEGG   Pan paniscus (bonobo): 100989264Help
Entry
100989264         CDS       T02283                                 

Gene name
USP51
Definition
ubiquitin specific peptidase 51
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100989264 (USP51)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100989264 (USP51)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100989264 (USP51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 678 aa AA seqDB search
MAQVRETSLPSGSGVRWISGGGGGASPEEAVGKAGKMEEAVAGATKASSRREAEEMKLEP
LQEREPAPEENLTWSSSGGDEKVLPSIPLRCHTSSSPVCPRRKPRPRPQRPRAWRGSRRR
SRPGSRPQTRRSCSGDLDGSGDPGGLGDWLLEVEFGQGPTGCSHVESFKVGKNWQKNLRL
IYQRFVWSGTPETRKRKAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHH
LAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQ
STCETKEQEPKLVKPKKKRRKKSVYTVGLRGLINLGNTCFMNCIVQALTHIPLLKDFFLS
DKHKCIMTSPSLCLVCEMSSLFHAMYSGSRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEF
LIAILDVLHRHSKDDSGGQEANNPNCCNCIIDQIFTGGLQSDVTCQACHSVSTTIDPCWD
ISLDLPGSCATFDSQNPERADSAVSRDDHIPGIPSLTDCLQWFTRPEHLGSSAKIKCNSC
QSYQESTKQLTMKKLPIVACFHLKRFEHVGKQRRKINTFISFPLELDMTPFLASTKESRM
KEGQPPTDCVPNENKYSLFAVINHHGTLESGHYTSFIRQQKDQWFSCDDAIITKATIEDL
LYSEGYLLFYHKQGLEKD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggttcgagaaacttctttgccctccggctctggggtccgctggatctccgga
ggtgggggaggagcctctcctgaggaggcggttgggaaggcggggaaaatggaggaggcg
gtggcgggggctacgaaggcgtcttcgagacgggaagctgaggagatgaaactggagcca
ttacaagagcgtgagcccgcgccggaggagaacttgacgtggagcagcagcggcggcgac
gagaaggtgctcccttcaatcccccttcgctgtcacaccagctcctcgcccgtttgcccg
cgccgcaagccccgccctcggccccagcggcccagggcctggcgtggatcccggcgcaga
tcccggcctgggtccaggcctcagacacggagaagctgctctggtgacctagacgggtcg
ggggatcctggcggcttaggggactggttgctggaggtcgagtttggtcagggtcccaca
ggctgctctcatgtggagagctttaaagtaggtaagaactggcagaagaacctgaggttg
atctaccagcgtttcgtttggagtgggaccccagagactaggaaacgtaaagcaaagtca
tgcatctgtcacgtatgtagtacccatatgaacagactccactcttgtctctcctgtgtc
ttttttggctgcttcactgagaaacatattcacaaacatgcagaaacaaagcagcaccat
ttagctgtagacctttatcatggggtcatatattgcttcatgtgtaaggattatgtatat
gacaaagacatagaacagattgccaaagaaacaaaagaaaaaattttgagattattaact
tccacctcaacagatgtttctcatcaacagtttatgacatcagggtttgaagacaagcaa
tcaacctgtgagacaaaggaacaggagccaaaattggtgaaacccaagaaaaagagaaga
aaaaagtcagtctatactgtaggcctgagagggctaatcaatcttgggaacacttgtttt
atgaattgtattgtccaggcacttacccatattcctctactgaaagatttcttcctctct
gacaagcacaaatgtataatgacaagccccagcttgtgtctggtctgtgaaatgtcttcg
ctttttcatgctatgtactctgggagccgaactcctcacattccctataagttactgcat
ctgatatggatccatgcagaacatttagcagggtacaggcagcaggatgcccatgagttc
cttattgcaatattagacgtgctacatagacacagcaaagatgatagtggtgggcaggag
gccaataaccccaactgctgtaactgcatcatagaccaaatctttacaggtggcctgcaa
tcagatgtcacatgtcaagcctgccatagtgtttctaccaccatagacccatgctgggac
atcagtttggacttgcctggctcttgtgccacattcgattcccagaacccagagagggct
gacagcgcagtgagcagggatgaccacataccaggaatcccctcacttacagactgtcta
cagtggtttacaaggccagagcacctaggaagcagtgccaaaatcaaatgcaatagttgc
caaagctaccaggagtctactaaacagctcacaatgaaaaaattacccattgtggcttgt
tttcatctcaagcggtttgagcatgtaggcaaacagaggcgaaagattaatacctttatc
tcctttcccttggagctggacatgactccgtttttggcctctactaaagagagcagaatg
aaagaaggccagccaccaacagattgtgtgcccaatgagaataagtattccttgtttgca
gtgattaatcaccatggaactttggaaagtggccactataccagcttcatccggcaacaa
aaggaccagtggttcagctgtgatgatgccatcatcaccaaggctaccattgaggactta
ctctacagtgaagggtatttactgttctatcacaaacagggtctagagaaagactag

DBGET integrated database retrieval system