KEGG   Pan paniscus (bonobo): 100989465Help
Entry
100989465         CDS       T02283                                 

Gene name
DAO
Definition
D-amino-acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pps00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pps00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:pps00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:pps04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRELTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQPDPLLQPGRGQIIKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGLRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtggtgattggagcaggagtcatcgggctgtccaccgccctctgcatccat
gagcgctaccactcagtcctgcagccactggacataaaggtctacgcggaccgcttcacc
ccactcaccaccaccgacgtggctgccggcctctggcagccctacctttctgaccccaac
aacccacaggaggcggactggagccaacagacctttgactatctcctgagccatgtccat
tctcctaacgctgaaaacctgggcctgttcctaatctcgggctacaacctcttccatgaa
gccattccggacccttcctggaaggacacagttctgggatttcgggagctgacccccaga
gagctggatatgttcccagattacggctatggctggttccacacaagcctaattctggag
ggaaagaactatctacagtggctgactgaaaggttaactgagaggggagtgaagttcttc
cagcgaaaagtggagtcttttgaggaggtggcaagagaaggcgcagacgtgattgtcaac
tgcactggggtatgggctggggcgctacaaccagaccccctgctgcagccaggccggggg
cagatcattaaggtggacgccccttggatgaagcactttattctcacccatgacccagag
agaggcatctacaattccccgtacatcatcccagggacccagacagttactcttggaggc
atcttccagttgggaaactggagtgaactaaacaatatccaggaccacaacaccatttgg
gaaggctgctgcagactggagcccacactgaagaatgcaagaattattggtgaacgaact
ggcttaaggccagtacgcccccagattcggctagaaagagaacagcttcgcactggacct
tcaaacacagaggtcatccacaactatggccatggaggctatgggctcaccatccactgg
ggatgtgccctggaggcagccaagctctttgggagaatcctggaagaaaagaaattgtcc
agaatgccaccatcccacctctga

DBGET integrated database retrieval system