KEGG   Pan paniscus (bonobo): 100989625Help
Entry
100989625         CDS       T02283                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03320  PPAR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04659  Th17 cell differentiation
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps04976  Bile secretion
pps05160  Hepatitis C
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05216  Thyroid cancer
pps05222  Small cell lung cancer
pps05223  Non-small cell lung cancer
pps05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100989625 (RXRA)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100989625 (RXRA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100989625 (RXRA)
   03320 PPAR signaling pathway
    100989625 (RXRA)
   04919 Thyroid hormone signaling pathway
    100989625 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100989625 (RXRA)
  Digestive system
   04976 Bile secretion
    100989625 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100989625 (RXRA)
   05202 Transcriptional misregulation in cancers
    100989625 (RXRA)
   05226 Gastric cancer
    100989625 (RXRA)
   05216 Thyroid cancer
    100989625 (RXRA)
   05222 Small cell lung cancer
    100989625 (RXRA)
   05223 Non-small cell lung cancer
    100989625 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100989625 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    100989625 (RXRA)
Transcription factors [BR:pps03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100989625 (RXRA)
Nuclear receptors [BR:pps03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100989625 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 100989625
NCBI-ProteinID: XP_003822498
Position
9
AA seq 365 aa AA seqDB search
MNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKG
FFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNE
NEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLF
TLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSA
HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVY
ASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA
PHQMT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctc
aaggtccccgcccacccctcaggaaacatggcttccttcaccaagcacatctgcgccatc
tgcggggaccgctcctcaggcaagcactacggagtgtacagctgcgaggggtgcaagggc
ttcttcaagcggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgc
ctgattgacaagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggcc
atgggcatgaagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgag
aatgaggtggagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggag
gctgagctggccgtggagcccaagaccgagacctacgtggaggcaaacatggggctgaac
cccagctcgccgaacgaccctgtcaccaacatttgccaagcagccgacaagcagcttttc
accctggtggagtgggccaagcggatcccacacttctcagagctgcccctggacgaccag
gtcatcctgctgcgggcaggctggaatgagctgctcatcgcctccttctcccaccgctcc
atcgccgtgaaggacgggatcctcctggccaccgggctgcacgtccaccggaacagcgcc
cacagcgcaggggtgggcgccatctttgacagggtgctgacggagcttgtgtccaagatg
cgggacatgcagatggacaagacggagctgggctgcctgcgcgccatcgtcctctttaac
cctgactccaaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctat
gcgtccttggaggcctactgcaagcacaagtacccagagcagccgggaaggttcgccaag
ctcttgctccgcctcccggctctgcgctccatcgggctcaaatgcctggaacatctcttc
ttcttcaagctcatcggggacacacccattgacaccttcctcatggagatgctggaggcg
ccgcaccaaatgacttag

DBGET integrated database retrieval system