KEGG   Pan paniscus (bonobo): 100989625Help
Entry
100989625         CDS       T02283                                 

Definition
retinoic acid receptor RXR-alpha-like
Orthology
K08524  
retinoid X receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pps04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:pps04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:pps03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pps04919]
Organismal Systems; Digestive system; Bile secretion [PATH:pps04976]
Human Diseases; Cancers; Pathways in cancer [PATH:pps05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:pps05202]
Human Diseases; Cancers; Thyroid cancer [PATH:pps05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:pps05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:pps05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:pps04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:pps05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 365 aa AA seqDB search
MNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKG
FFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNE
NEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLF
TLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSA
HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVY
ASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA
PHQMT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctc
aaggtccccgcccacccctcaggaaacatggcttccttcaccaagcacatctgcgccatc
tgcggggaccgctcctcaggcaagcactacggagtgtacagctgcgaggggtgcaagggc
ttcttcaagcggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgc
ctgattgacaagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggcc
atgggcatgaagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgag
aatgaggtggagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggag
gctgagctggccgtggagcccaagaccgagacctacgtggaggcaaacatggggctgaac
cccagctcgccgaacgaccctgtcaccaacatttgccaagcagccgacaagcagcttttc
accctggtggagtgggccaagcggatcccacacttctcagagctgcccctggacgaccag
gtcatcctgctgcgggcaggctggaatgagctgctcatcgcctccttctcccaccgctcc
atcgccgtgaaggacgggatcctcctggccaccgggctgcacgtccaccggaacagcgcc
cacagcgcaggggtgggcgccatctttgacagggtgctgacggagcttgtgtccaagatg
cgggacatgcagatggacaagacggagctgggctgcctgcgcgccatcgtcctctttaac
cctgactccaaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctat
gcgtccttggaggcctactgcaagcacaagtacccagagcagccgggaaggttcgccaag
ctcttgctccgcctcccggctctgcgctccatcgggctcaaatgcctggaacatctcttc
ttcttcaagctcatcggggacacacccattgacaccttcctcatggagatgctggaggcg
ccgcaccaaatgacttag

DBGET integrated database retrieval system