KEGG   Pan paniscus (bonobo): 100989781Help
Entry
100989781         CDS       T02283                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 4
  KO
K05200  glutamate receptor 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04713  Circadian entrainment
pps04723  Retrograde endocannabinoid signaling
pps04724  Glutamatergic synapse
pps04728  Dopaminergic synapse
pps05031  Amphetamine addiction
pps05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100989781 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100989781 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100989781 (GRIA4)
   04728 Dopaminergic synapse
    100989781 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100989781 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100989781 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100989781 (GRIA4)
   05033 Nicotine addiction
    100989781 (GRIA4)
Ion channels [BR:pps04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100989781 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 100989781
NCBI-ProteinID: XP_003828407
Position
11
AA seq 884 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKVAKSAQTFNPTSSQNTQNLATYREGYNVYGTESIKI
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacacattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcatacagaagagccagaggat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctagccaaacaaacagaaattgcctatggaacactggattcagggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtgttcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggt
gactccaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaaggtggcaaagagtgcacagacttttaacccaacttcc
tcgcagaatacccagaatttagcaacctatagagaaggttacaacgtatatggaaccgaa
agtattaaaatttag

DBGET integrated database retrieval system