KEGG   Pan paniscus (bonobo): 100989841Help
Entry
100989841         CDS       T02283                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05034  Alcoholism
pps05203  Viral carcinogenesis
pps05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pps00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100989841
  Immune diseases
   05322 Systemic lupus erythematosus
    100989841
  Substance dependence
   05034 Alcoholism
    100989841
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100989841
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100989841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100989841
NCBI-ProteinID: XP_003804591
Position
6
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccagccaagtctgctcccgccccgaagaagggctccaagaaggcggtgacc
aaagcgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagttactctgtg
tacgtgtacaaggtgctgaagcaggtccatcccgacactggcatctcttccaaggccatg
ggtatcatgaattctttcgttaacgacatatttgagcgcatcgcgggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgcttcccggagagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system