KEGG   Pan paniscus (bonobo): 100990061Help
Entry
100990061         CDS       T02283                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100990061 (USP38)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100990061 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1042 aa AA seqDB search
MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQERELREYVSQVTKVSNLLQNIWKAEPATLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVY
SFKNDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDGEKTLIEKMFGGKLRTHIRC
LNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDPASSPSIQDGGLMQASVPGPSEEPVVY
NPTTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKILVNKDVPQKPGGETTPSVTD
LLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRITSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKLVPY
LLSSVVVHSGISSESGHYYSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPNAVF
EQDLENKEMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNP
TSGLWINGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPP
GSCGPTGGGGGGGFNTVGRLVF
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggagggccttgtgagttcctcgcatcccctgcccctcaagcgggtg
attgtgcggaaggtggtggaatcggcggagcactggctagacgaggcgcagtgtgaggcc
atgtttgacctgacgacccggctcatcctggagggccaggaccctttccagcggcaggtg
gggcaccaggtgctggaggcctacgcacgataccaccggccagagttcgagtccttcttc
aacaagaccttcgtgttgggcctccttcatcagggctaccactctctggacaggaaggat
gtagccatcctggactacattcacaacggcctgaagctgattatgagctgtccgtcggtg
ctggatctctttagtctcctgcaggtagaggtgttacggatggtgtgtgagaggccggag
ccgcagctctgtgcccgactgagcgaccttctgaccgactttgtgcaatgcatccccaag
gggaaattgtccatcacgttctgtcaacagctggttcgaacgataggccatttccagtgc
gtgtccacccaggaaagagagctgcgggaatatgtctcccaggtgacaaaagttagtaac
ttgctgcagaacatctggaaggccgagcctgccacactgctgccttccctgcaagaagtt
tttgcaagcatctcttccacagatgcatcatttgaaccttctgtagcattggcaagcctt
gtgcagcatattcctcttcagatgattacagttctcatcaggagccttactacagatcca
aatgtaaaagatgcaagtatgacccaagccctttgcagaatgattgactggctatcctgg
ccattggctcagcatgtggatacatgggtaattgcactcctgaaaggactggcagctgtc
cagaagtttactattttgatagatgttactttgctgaaaatagaactggtttttaatcga
ctttggtttcctcttgtgagacctggtgctcttgcagttctttctcacatgctgcttagc
tttcagcattctccagaggcgttccatttgattgttcctcatgtggttaatttggtttat
tctttcaaaaatgatggactgccttccagtacagccttcttagtacaattaacagaattg
atacactgtatgatgtatcattattctggatttccagatctctatgaacctattctggag
gcaataaaggattttcctaagcccagtgaagagaagattaagttaattctcaatcaaagt
gcctggacttctcaatccaattctttggcgtcttgcttgtctagactttctggaaaatct
gaaactgggaaaactggtcttattaacctaggaaatacatgttatatgaacagtgttata
caagccttgtttatggccacagatttcaggagacaagtattatctttaaatctaaatggg
tgcaattcattaatgaaaaaattacagcatctttttgcctttctggctcatacgcagagg
gaagcatacgcacctcggatattctttgaggcttccagacctccatggtttactcccaga
tcacagcaagactgttctgaatacctcagatttctccttgacaggctccatgaagaagaa
aagatcttgaaagttcaggcctcacacaagccttctgaaattctggaatgcagtgaaact
tctttacaggaagtagctagtaaagcagcagtactcacagagacccctcgtacaagtgac
ggtgagaagactttaatagaaaaaatgtttggaggaaaactacgaactcacatacgttgt
ttgaactgcaggagtacctcacaaaaagtggaagcctttacagatctttcgcttgccttt
tgtccttcctcttctttggaaaacatgtctgtccaagacccagcatcatcacccagcata
caagatggtggtctaatgcaagcctctgtacccggtccttcagaagaaccagtagtttat
aatccaacaacagctgccttcatctgtgactcacttgtgaatgaaaaaaccataggcagt
cctcctaatgagttttactgttctgaaaacacttctgtccctaatgaatctaacaagatt
cttgttaataaagatgtacctcagaaaccaggaggtgaaaccacaccttcagtaactgac
ttactaaattattttttggctccagagattcttactggtgataaccaatattattgtgaa
aactgtgcctctctgcaaaatgctgagaaaactatgcaaatcacggaggaacctgaatac
cttattcttactctcctgagattttcatatgatcagaagtatcatgtgagaaggaaaatt
ttagacaatgtatcactgccactggttttggagttgccagttaaaagaattacttctttc
tcttcattgtcagaaagttggtctgtagatgttgacttcactgatcttagtgagaacctt
gctaaaaaattaaagccttcagggactgatgaagcttcctgcacaaaattggtgccctat
ctattaagttctgttgtggttcactctggtatatcctctgaaagtgggcattactattct
tatgccagaaatatcacaagtacagactcttcatatcagatgtaccaccagtctgaggct
ctggcattagcatcctcccagagtcatttactagggagagatagtcccaatgcagttttt
gaacaggatttggaaaataaggaaatgtcaaaagaatggtttttatttaatgacagtaga
gtgacatttacttcatttcagtcagtccagaaaattacgagcaggtttccaaaggacaca
gcttatgtgcttttgtataaaaaacagcatagtactaatggtttaagtggtaataaccca
accagtggactctggataaatggagacccacctctacagaaagaacttatggatgctata
acaaaagacaataaactatatttacaggaacaagagttgaatgctcgagcccgggccctc
caagctgcatctgcttcatgttcatttcggcccaatggatttgatgacaacgacccacca
ggaagctgtggaccaactggtggagggggtggaggaggatttaatacagttggcagactc
gtattttga

DBGET integrated database retrieval system