KEGG   Pan paniscus (bonobo): 100990234Help
Entry
100990234         CDS       T02283                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100990234 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100990234 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    100990234 (GSTP1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100990234 (GSTP1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100990234 (GSTP1)
  Drug resistance
   01524 Platinum drug resistance
    100990234 (GSTP1)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100990234 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacgtctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctcctttgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system