KEGG   Pan paniscus (bonobo): 100990675Help
Entry
100990675         CDS       T02283                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 136 aa AA seqDB search
SSSPSSSQPHSSHCRTKASSLCHHASLPWVKRNHVGPAKATSPSLRLRRWRPFLRLPSLG
LHSVAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFME
RDPDELRFNAIALSAA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
tcctcctcgccatcctcatcacagcctcattctagccactgcagaacgaaggcctcatca
ttgtgtcaccatgcatccctgccctgggtcaaacgtaaccatgtaggccctgcaaaggct
accagtccatctctccgtcttcgtcgctggcgacccttcttacgtctaccatctttgggt
ctccattctgttgcaccaagtatagatgagaaagtagatcttcattttattgcattagtt
catgtagatgggcatctctatgaattagatgggcggaagccatttccaattaaccatggt
gaaactagtgatgaaactttattagaggatgccatagaagtttgcaagaagtttatggag
cgcgaccctgatgaactaagatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system