KEGG   Pan paniscus (bonobo): 100991032Help
Entry
100991032         CDS       T02283                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccacccaccgtgtaccacgaacggcagcgc
ctggagctgtgtgctgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgatgtcaatgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtactggggctgatcctgaacctgccctcgcccgtgtcgctggggctgctgtcactgccg
ctgcgccggcggcactgggtggccctgcgccaggtggacggtgtctactacaacctggac
tccaagctgcgggcgcccgaggccctgggggatgaggacggagtcagggccttcctggcg
gctgcgctggcccagggcctgtgcgaggtgctgctggtagtgaccaaggaggtggaggag
aagggcagctggctgcggacagactga

DBGET integrated database retrieval system