KEGG   Pan paniscus (bonobo): 100991072Help
Entry
100991072         CDS       T02283                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
pps  Pan paniscus (bonobo)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100991072 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100991072 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100991072 (THBS2)
  Cell communication
   04510 Focal adhesion
    100991072 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100991072 (THBS2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100991072 (THBS2)
  Exosomal proteins of colorectal cancer cells
   100991072 (THBS2)
  Exosomal proteins of bladder cancer cells
   100991072 (THBS2)
Heparan sulfate/heparin binding proteins [BR:pps00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100991072 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1172 aa AA seqDB search
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTSCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKMPRCVNTQPGFHCLPCPPRYRGNQPVGVGLDAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaggctggtcctgctggctctgtgggtgtggcccagcacgcaagctggtcac
caggacaaagacacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttt
gactacatcccaccggtgaacgcagatgacctcagcaagatcaccaagatcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ttggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaatggcccc
gcggacacgctggatctcacctactggattgacggcacccggcacgtggtctccctggag
gacgtcggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggcgagacc
tacagcttgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctctgccagagagagt
cacttcaggggtttgcttcagaacgtccacctagtgtttgaaaactctgtggaagacatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acagagacgctgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcccgaggtgtgcgaacgctcgtgtgaggagctgggaaacatggtccaggagctc
tcggggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaatgat
aaccagtttctctgggagctcatcggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgaaacgtgggtggtggacagctgcacctcg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcctgcaacctgc
gccagtccgtcctttgtggaaggcgaatgctgcccttcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggacccagtgctctgtgacgtgtggctctggg
acccagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagtctgagcaagtgtgacacccgcatccggcaggacggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagttggcaatatcacacgc
atccgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggc
cgggagaccaaagcctgccagggcgccccatgcccaatcgatggccgctggagcccctgg
tccccgtggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggatgtgcaggagcgt
cagatgtgcaacaagaggagctgccctgtggatggctgtttatccaacccctgcttcccg
ggagcccagtgcagcagcttccccgatgggtcctggtcatgcggctcctgccctgtgggc
ttcttgggcaatggcacccactgtgaggacctggacgagtgtgccctggtccccgacatc
tgcttctccaccagcaagatgcctcgctgtgtcaacactcagcccggcttccactgcctg
ccctgcccgccccgatacagagggaaccagcccgtcggggtcggcctggacgcagccaag
acggaaaagcaagtgtgcgagcccgaaaacccatgcaaggacaagacacacaactgccac
aagcacgcggagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgc
cagacaggctacgcgggcgacgggctcatctgcggggaggactcggacctggacggctgg
cccaacctcaatctggtctgcgccaccaacgccacctaccactgcatcaaggataactgc
ccccatctgccaaattctgggcaggaagactttgacaaggacgggattggcgatgcctgt
gatgatgatgatgacaatgacggtgtgaccgatgagaaggacaactgccagctcctcttc
aatccccgccaggctgactatgacaaggatgaggttggggaccgctgtgacaactgccct
tacgtgcacaaccctgcccagatcgacacagacaacaatggagagggtgacgcctgctcc
gtggacattgatggggacgatgtcttcaatgaacgagacaattgtccctacgtctacaac
actgaccagagggacacggatggtgacggtgtgggggatcactgtgacaactgccccctg
gtgcacaaccctgaccagaccgacgtggacaatgaccttgttggggaccagtgtgacaac
aacgaggacatagatgacgacggccaccagaacaaccaggacaactgcccctacatctcc
aacgccaaccaggctgaccatgacagagacggccagggcgacgcctgtgaccccgatgat
gacaacgatggcgtccccgatgacagggacaactgccggcttgtgttcaacccagaccag
gaggacttggacggtgatggacggggtgatatttgtaaagatgattttgacaatgacaac
atcccagatattgatgatgtgtgtcctgaaaacaatgccatcagtgagacagacttcagg
aacttccagatggtccccttggatcccaaagggaccacccaaattgatcccaactgggtc
attcgccatcaaggcaaggagctggttcagacagccaactcggaccccggcatcgctgta
ggttttgacgagtttgggtctgtggacttcagtggcacattctacgtaaacactgaccgg
gacgacgactatgccggcttcgtctttggttaccagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacgcagacctactgggaggaccagcccacgcgggcctatggctac
tccggcgtgtccctcaaggtggtgaactccaccacagggacgggcgagcacctgaggaac
gcgctgtggcacacggggaacacgccggggcaggtgcgaaccttatggcacgaccccagg
aacattggctggaaggactacacggcctataggtggcacctgactcacaggcccaagacc
ggctacatcagagtcttagtgcatgaaggaaaacaggtcatggcagactcaggacctatc
tatgaccaaacctacgctggcgggcggctgggtctatttgtcttctctcaagaaatggtc
tatttctcagacctcaagtacgaatgcagagatatttaa

DBGET integrated database retrieval system