KEGG   Pan paniscus (bonobo): 100991095Help
Entry
100991095         CDS       T02283                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100991095 (DYRK3)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100991095 (DYRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 588 aa AA seqDB search
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCPNVLCNPSEPPPPR
RLNMTTEQFTRDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIX
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGGIPLCSVLPKLIS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcacagctcgtgggcctgggcggaaggatgcggggccgcctggggccgggctc
ccgccccagcagcggaggttgggggatggtgtctatgacaccttcatgatgatagatgaa
accaaatgtcccccctgtccaaatgtactctgcaatccttctgaaccacctccacccaga
agactaaatatgaccactgagcagtttacaagagatcatactcagcactttttggatgga
ggtgagatgaaggtagaacagctgtttcaagaatttggcaacagaaaatccaatactatt
cagtcagatggcatcagtgactctgaaaaatgctctcctactgtttctcagggtaaaagt
tcagattgcttgaatacagtaaaatccaacagttcatccaaggcacccaaagtggtgcct
ctcactccagaacaagccctgaagcaatataaacaccacctcactgcctatgagaaactg
gaaataattaattatccagaaatttactttgtaggtccaaatgccaagaaaagacatgga
gttattggtggtcccaataatggagggtatgatgatgcagatggggcctatattcatgta
cctcgagaccatctagcttatcgatatgaggtgctgaaaattattggcaaggggagtttt
gggcaggtggccagggtctatgatcacaaacttcgacagtacgtggccctaaaaatggtg
cgcaatgagaagcgctttcatcgtcaagcagctgaggagatccggattttggagcatctt
aagaaacaggataaaactggtagtatgaacgttatccacatgctggaaagtttcacattc
cggaaccatgtttgcatggcctttgaattgctgagcatagacctttatgagctgattnaa
aaaaataagtttcagggttttagcgtccagttggtacgcaagtttgcccagtccatcttg
caatctttggatgccctccacaaaaataagattattcactgcgatctgaagccagaaaac
attctcctgaaacaccacgggcgcagttcaaccaaggtcattgactttgggtccagctgt
ttcgagtaccagaagctctacacatatatccagtctcggttctacagagctccagaaatc
atcttaggaagccgctacagcacaccaattgacatatggagttttggctgcatccttgca
gaacttttaacaggacagcctctcttccctggagaggatgaaggagaccagttggcctgc
atgatggagcttctagggatgccaccaccaaaacttctggagcaatccaaacgtgccaag
tactttattaattccaagggcataccccgctactgctctgtgactacccaggcagatggg
agggttgtgcttgtggggggtcgctcacgtaggggtaaaaagcggggtcccccaggcagc
aaagactgggggacagcactgaaagggtgtgatgactacttgtttatagagttcttgaaa
aggtgtcttcactgggacccctctgcccgcttgaccccagctcaagcattaagacaccct
tggattagcaagtctgtccccagacctctcaccaccatagacaaggtgtcaggaaaacgg
gtagttaatcctgcaagtgctttccagggattgggttctaagctgcctccagttgttgga
atagccaataagcttaaagctaacttaatgtcagaaaccaatggtggtatacccctatgc
agtgtattgccaaaactgattagctag

DBGET integrated database retrieval system