KEGG   Pan paniscus (bonobo): 100991116Help
Entry
100991116         CDS       T02283                                 

Gene name
ADCY6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100991116 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100991116 (ADCY6)
   04024 cAMP signaling pathway
    100991116 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100991116 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100991116 (ADCY6)
  Cellular commiunity
   04540 Gap junction
    100991116 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100991116 (ADCY6)
   04062 Chemokine signaling pathway
    100991116 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100991116 (ADCY6)
   04912 GnRH signaling pathway
    100991116 (ADCY6)
   04913 Ovarian Steroidogenesis
    100991116 (ADCY6)
   04915 Estrogen signaling pathway
    100991116 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100991116 (ADCY6)
   04921 Oxytocin signaling pathway
    100991116 (ADCY6)
   04918 Thyroid hormone synthesis
    100991116 (ADCY6)
   04916 Melanogenesis
    100991116 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100991116 (ADCY6)
   04270 Vascular smooth muscle contraction
    100991116 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100991116 (ADCY6)
   04971 Gastric acid secretion
    100991116 (ADCY6)
   04972 Pancreatic secretion
    100991116 (ADCY6)
   04976 Bile secretion
    100991116 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100991116 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100991116 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100991116 (ADCY6)
   04727 GABAergic synapse
    100991116 (ADCY6)
   04725 Cholinergic synapse
    100991116 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100991116 (ADCY6)
  Sensory system
   04742 Taste transduction
    100991116 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100991116 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100991116 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100991116 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100991116 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100991116 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100991116 (ADCY6)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100991116 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPHPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLIAVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacagcggtgctgctggctttccacgccgcacccgcccgccctcaccctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgctctcgcagcagacccgcgcagcccctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacacgctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtgtctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtattgccccagcacgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcaccgcgcaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaggcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagcgggcgcgtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaacggggactacgaggtggagccaggccgtggtggcgagcgcaacgcg
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgcttcatctgcttcatccagcttctcatcttcccacactccaccctgatgcttgggatc
tatgccagcatcttcctgctgctgctaatcgccgtgctgatctgtgccgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcattgtccgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtgtttacttctgccattgccaac
atgttcacctgtaaccacacccccatacggacctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccatgcccacctgcagctttcctgagtacttcatcgggaacatg
ctgctgagtctcttggccagctctgtcttcctacacatcagcagcatcgggaagttggcc
atgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcctcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggcggcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgtgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctagaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagattatcagc
gaggagcggttccggcagctggaaaagatcaagacgattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctggct
gactacgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccacagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttaa

DBGET integrated database retrieval system