KEGG   Pan paniscus (bonobo): 100991236Help
Entry
100991236         CDS       T02283                                 

Gene name
TMX3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100991236 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 454 aa AA seqDB search
MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLE
PIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD
DIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYF
FSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLY
ELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLL
MDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIV
FDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ
EQVEESKEQQEPSSGGSVVPTAQEPKDVLEKKKD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtggaagagttggacggccctgcggctctgcgccacagttgttgtacttgat
atggtcgtctgtaaaggatttgtagaagatttagatgaatcgtttaaagaaaatcgaaat
gatgacatttggcttgtagatttttatgcaccatggtgtggccattgtaaaaagctggaa
ccgatttggaatgaagttggtcttgagatgaaaagcattggttctccagttaaggttgga
aagatggatgctacttcctattctagcattgcttcagagtttggagttcgaggttatcca
acaattaagctattaaaaggggacttggcatataattatagaggaccacgaacaaaagat
gatattattgagtttgctcacagagtatctggggctctaattcgaccacttccaagtcaa
caaatgtttgaacatatgcagaagagacaccgtgtatttttcgtttatgtaggtggagaa
tcacctttgaaagagaaatacatagatgctgcttcagaattgattgtatatacatacttc
ttttctgcctcagaagaagtggttcctgagtatgtgacactaaaagagatgccggctgtg
cttgttttcaaagatgaaacttactttgtttatgatgagtatgaagatggtgatctgtcg
tcatggatcaacagggaaaggtttcagaattaccttgctatggatggcttcctcttgtat
gaacttggagacacaggaaagcttgtggctcttgcagttattgatgagaaaaatacatca
gttgaacataccagattgaagtcaattatccaggaagttgcaagagattacagagacctc
ttccatagggattttcagtttggccacatggatggaaatgactacataaataccttgctg
atggatgaattgacagtcccaactgtagttgtactgaatacttcaaaccagcaatatttc
ttgctagatagacagattaagaatgttgaagacatggtccagtttattaataacattttg
gatggcacagtagaagcccaaggaggtgatagcattttgcagagattgaaaaggatagta
tttgatgccaaatctactattgtgtctatattcaagagctcaccactgatgggctgcttt
ctctttggcctgccactgggtgtcatcagtatcatgtgctatggaatctacacagccgac
acagatggaggttatatagaagaacgatatgaagtgtctaaaagtgaaaatgaaaaccaa
gaacaggtagaagagagcaaagaacagcaggagcccagcagtggaggatctgtagtgcct
acagcgcaggagcccaaggatgtattagaaaagaagaaagattga

DBGET integrated database retrieval system