KEGG   Pan paniscus (bonobo): 100991287Help
Entry
100991287         CDS       T02283                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 361 aa AA seqDB search
MCNDGDMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLA
YKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFL
NYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTC
ETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVK
KLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHC
GSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSR
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacgatggggatatgggcgccaatgcttcggcattagagaaagagattggtcca
gaacagtttccggtcaatgagcactattttggattagtcaattttgggaatacctgctac
tgcaattcagttcttcaagcactttatttttgtcgtccatttcgggaaaaagttcttgcg
tataagagtcaacctaggaaaaaggagagccttcttacatgcttagcagatctcttccat
agcatagccactcagaagaaaaaggttggagtaataccccctaagaagttcatcacaaga
ttacggaaagaaaacgagctttttgacaactacatgcaacaagatgcccatgaattctta
aattacctactaaatacaattgctgatattttacaagaagagagaaagcaggaaaaacaa
aatggtcgcttacctaatggtaatattgataatgaaaataataacagcacaccagaccca
acgtgggttcatgagatttttcagggaacattaactaatgaaaccagatgtcttacttgt
gaaactataagcagcaaagatgaagattttttagacctttctgttgacgtggaacaaaat
acatcaattactcactgcttaaggggtttcagcaacacagaaactctgtgcagtgaatac
aagtattactgtgaagagtgtcgcagcaaacaggaagcacacaaacggatgaaagttaaa
aaactgcccatgattctagctctacacctgaagagatttaaatatatggatcaacttcat
cgatatacaaaactctcttaccgggtagtttttcctttagaacttcgtctgtttaacact
tcaggtgatgccaccaatccagacagaatgtacgaccttgttgctgttgtggttcactgt
ggaagtggtcccaatcgaggccattatattgcaatagttaagagtcatgatttttggttg
ttgtttgatgacgacattgtagaaaaaatagatgcacaagctattgaagaattctacggg
ttgacatcagatatctcaaagaactctgagtctggttacatccttttctatcagtctcgg
gactga

DBGET integrated database retrieval system