KEGG   Pan paniscus (bonobo): 100991287Help
Entry
100991287         CDS       T02283                                 

Gene name
USP12
Definition
(RefSeq) ubiquitin specific peptidase 12
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100991287 (USP12)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100991287 (USP12)
Ubiquitin system [BR:pps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100991287 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 250 aa AA seqDB search
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagatgcccatgaattcttaaattacctactaaatacaattgctgatatttta
caagaagagagaaagcaggaaaaacaaaatggtcgcttacctaatggtaatattgataat
gaaaataataacagcacaccagacccaacgtgggttcatgagatttttcagggaacatta
actaatgaaaccagatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaatacatcaattactcactgcttaaggggtttcagc
aacacagaaactctgtgcagtgaatacaagtattactgtgaagagtgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctacacctgaag
agatttaaatatatggatcaacttcatcgatatacaaaactctcttaccgggtagttttt
cctttagaacttcgtctgtttaacacttcaggtgatgccaccaatccagacagaatgtac
gaccttgttgctgttgtggttcactgtggaagtggtcccaatcgaggccattatattgca
atagttaagagtcatgatttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system