KEGG   Pan paniscus (bonobo): 100991417Help
Entry
100991417         CDS       T02283                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04371  Apelin signaling pathway
pps04530  Tight junction
pps04710  Circadian rhythm
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps04920  Adipocytokine signaling pathway
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease (NAFLD)
pps05410  Hypertrophic cardiomyopathy (HCM)
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100991417 (PRKAA2)
   04068 FoxO signaling pathway
    100991417 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100991417 (PRKAA2)
   04152 AMPK signaling pathway
    100991417 (PRKAA2)
   04150 mTOR signaling pathway
    100991417 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100991417 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    100991417 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100991417 (PRKAA2)
   04922 Glucagon signaling pathway
    100991417 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100991417 (PRKAA2)
   04921 Oxytocin signaling pathway
    100991417 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    100991417 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100991417 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    100991417 (PRKAA2)
   04714 Thermogenesis
    100991417 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100991417 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    100991417 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100991417 (PRKAA2)
   04931 Insulin resistance
    100991417 (PRKAA2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100991417 (PRKAA2)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100991417 (PRKAA2)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100991417 (PRKAA2)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100991417 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100991417 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100991417
NCBI-ProteinID: XP_014200912
Position
1
AA seq 629 aa AA seqDB search
MYNGKPKKKHVMKNKRGLPASLGTLAYPPRSTCRLRPSLGPRASGAAPPALPPSAPRPLP
PLSLLRVPPQEPLTPGSGRLALPPSAPPRPAPPAARPVTWSTCCPHPKVGEHQLTGHKVA
VKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFD
YICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNM
MSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLF
KKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSY
DANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA
SSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWH
LGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNR
SYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGS
TLSSVSPRLGSHTMDFFEMCASLITTLAR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatggaaaacctaaaaagaaacatgtaatgaaaaacaaaaggggcctccctgcc
tccctcggcaccctcgcctacccccctcgcagcacctgtcgcctccgcccctcgctcgga
ccccgcgcatctggcgcggcccctcccgcactcccgcccagcgccccgcgtcccctgccc
ccgctgtcgctgcttcgggttccgccgcaggagcctctcactcccgggagcgggcgcctc
gcgctccctccctcggccccgccccgccccgccccgcccgccgctcgcccagtgacttgg
tcaacatgttgtcctcaccctaaagttggagaacatcaattaacaggccataaagtggca
gttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaaataaaacga
gaaattcaaaatctaaaactctttcgtcatcctcatattatcaaactataccaggtgatc
agcactccaacagatttttttatggtaatggaatatgtgtctggaggtgaattatttgac
tacatctgtaagcatggacgggttgaagagatggaagccaggcggctctttcagcagatt
ctgtctgctgtggattactgtcataggcatatggttgttcatcgagacctgaaaccagag
aatgttctgttggacgcacacatgaatgccaagatagccgattttggattatctaatatg
atgtcagatggtgaatttctgagaactagttgcggatctccaaattatgcagcacctgaa
gtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgtggtgttatc
ttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtacctacgttattt
aagaagatccgagggggtgtcttttatatcccagaatatctcaatcgttctgtcgccact
ctcctgatgcatatgctgcaggttgacccactgaaacgagcaactatcaaagacataaga
gagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagacccttcctat
gatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaatttgaatgtaca
gaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagcttgcggtggct
tatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttctacctcgcc
tctagtcctccatctggttcttttatggatgatagtgccatgcatattcccccaggcctg
aaacctcatccagaaaggatgccacctcttatagcagacagccccaaagcaagatgtcca
ctggatgcactgaatacgactaagcccaaatctttagctgtgaaaaaagctaagtggcat
cttggaatccgaagtcagagcaaaccgtatgacattatggctgaagtttaccgagctatg
aagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgtaagaagaaaa
aatccagtgactggcaattacgtgaaaatgagcttacaactttacctggttgataacagg
agctatcttttggactttaaaagcattgatgatgaagtagtggagcagagatctggttcc
tcaacacctcagcgttcctgttctgctgctggcttacacagaccaagatcaagttttgat
tccacaactgcagagagccattcactttctggctctctcactggctctttgaccggaagc
acattgtcttcagtttcacctcgcctgggcagtcacaccatggatttttttgaaatgtgt
gccagtctgattactactttagcccgttga

DBGET integrated database retrieval system