KEGG   Pan paniscus (bonobo): 100991484Help
Entry
100991484         CDS       T02283                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00062  Fatty acid elongation
pps00071  Fatty acid degradation
pps00280  Valine, leucine and isoleucine degradation
pps00310  Lysine degradation
pps00380  Tryptophan metabolism
pps00410  beta-Alanine metabolism
pps00640  Propanoate metabolism
pps00650  Butanoate metabolism
pps01100  Metabolic pathways
pps01200  Carbon metabolism
pps01212  Fatty acid metabolism
Module
pps_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
pps_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pps_M00085  Fatty acid biosynthesis, elongation, mitochondria
pps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100991484 (ECHS1)
   00650 Butanoate metabolism
    100991484 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100991484 (ECHS1)
   00071 Fatty acid degradation
    100991484 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100991484 (ECHS1)
   00310 Lysine degradation
    100991484 (ECHS1)
   00380 Tryptophan metabolism
    100991484 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100991484 (ECHS1)
Enzymes [BR:pps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100991484 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100991484
NCBI-ProteinID: XP_003816300
Position
10
AA seq 290 aa AA seqDB search
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHW
DHLTQMKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIIVTMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcgtgtcctgctgtcctgcgtccgcggcccgctgaggcccccggttcgc
tgtcccgcctggcgtcccttcgcctcgggtgctaactttgagtacatcatcgcagaaaaa
agagggaagaataacaccgtggggttgatccaactgaaccgccccaaggccctcaatgca
ctttgcgatggcctgattgacgagctcaaccaggccctgaagaccttcgaggaggaccca
gccgtgggggccattgtcctcaccggcggggataaggcctttgcagctggagctgatatc
aaggaaatgcagaacctgagtttccaggactgttactccagcaagttcttgaagcactgg
gaccacctcacccagatgaagaagccagtcatcgctgctgtcaatggctatgcttttggc
gggggctgtgagcttgccatgatgtgtgatatcatctatgccggtgagaaggcccagttt
gcacagccggagatcttaataggaaccatcccaggtgcgggcggcacccagagactcacc
cgtgctgttgggaagtcgctggcgatggagatggtcctcaccggtgaccggatctcagcc
caggacgccaagcaagcaggtcttgtaagcaagatttgtcctgttgagacactggtggaa
gaagccatccagtgtgcagaaaaaattgccagcaattctaaaattatagtaacgatggcc
aaagaatcagtgaatgcagcttttgaaatgacattaacagaaggaagtaagttggagaag
aaactcttttattcaacctttgccaccgatgaccggaaagaagggatgactgcgtttgtg
gaaaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system