KEGG   Pan paniscus (bonobo): 100991589Help
Entry
100991589         CDS       T02283                                 

Gene name
CHP2
Definition
(RefSeq) calcineurin like EF-hand protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
pps  Pan paniscus (bonobo)
Brite
Protein phosphatases and associated proteins [BR:pps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100991589 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST TerB EF-hand_9 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 100991589
NCBI-ProteinID: XP_003813748
Position
16
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccaggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagatctccaggcatgagatgctgcaggttctc
cgtctgatggttggggtacaggtgacagaagagcagctggagaacattgctgaccgcaca
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system