KEGG   Pan paniscus (bonobo): 100991644Help
Entry
100991644         CDS       T02283                                 

Gene name
FCGR2A
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
pps  Pan paniscus (bonobo)
Pathway
Phagosome
Osteoclast differentiation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:pps04145]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:pps04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:pps04380]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:pps05322]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:pps05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:pps05152]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:pps05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 317 aa AA seqDB search
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPNFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQAPSVGSSSPVGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEEINNDYETADGGYMTLNPRAPTDDD
KNVYLTLPPNNHVNSNN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccccaaag
gctgtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctg
acatgccggggggctcgcagccctgagagcgactccattcagtggttccacaatgggaat
ctcatccccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggg
gagtacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctt
tccgaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcgtg
ctgaggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatgga
aaatcccagaaattctcccatttggatcccaacttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcct
gtgaccatcactgtccaagcgcccagcgtgggcagctcttcaccagtggggatcattgtg
gctgtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgag
ccacctggacgtcaaatgattgccatcagaaagagacaacttgaagaaatcaacaatgac
tatgaaacagctgacggtggctacatgactctgaaccccagggcacctactgacgatgat
aaaaacgtctacctgactcttcctcccaacaaccatgtcaacagtaataactaa

DBGET integrated database retrieval system