KEGG   Pan paniscus (bonobo): 100991644Help
Entry
100991644         CDS       T02283                                 

Gene name
FCGR2A
Definition
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Orthology
K06472  
low affinity immunoglobulin gamma Fc region receptor II-a
Organism
pps  Pan paniscus (bonobo)
Pathway
Phagosome
Osteoclast differentiation
Platelet activation
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100991644 (FCGR2A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100991644 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    100991644 (FCGR2A)
  Development
   04380 Osteoclast differentiation
    100991644 (FCGR2A)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    100991644 (FCGR2A)
  Infectious diseases
   05150 Staphylococcus aureus infection
    100991644 (FCGR2A)
   05152 Tuberculosis
    100991644 (FCGR2A)
   05140 Leishmaniasis
    100991644 (FCGR2A)
Cellular antigens [BR:pps04090]
 Proteins
  100991644 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 317 aa AA seqDB search
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCRGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPNFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQAPSVGSSSPVGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEEINNDYETADGGYMTLNPRAPTDDD
KNVYLTLPPNNHVNSNN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccccaaag
gctgtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctg
acatgccggggggctcgcagccctgagagcgactccattcagtggttccacaatgggaat
ctcatccccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggg
gagtacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctt
tccgaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcgtg
ctgaggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatgga
aaatcccagaaattctcccatttggatcccaacttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcct
gtgaccatcactgtccaagcgcccagcgtgggcagctcttcaccagtggggatcattgtg
gctgtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgag
ccacctggacgtcaaatgattgccatcagaaagagacaacttgaagaaatcaacaatgac
tatgaaacagctgacggtggctacatgactctgaaccccagggcacctactgacgatgat
aaaaacgtctacctgactcttcctcccaacaaccatgtcaacagtaataactaa

DBGET integrated database retrieval system