KEGG   Pan paniscus (bonobo): 100991696Help
Entry
100991696         CDS       T02283                                 

Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100991696
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100991696
   00982 Drug metabolism - cytochrome P450
    100991696
   00983 Drug metabolism - other enzymes
    100991696
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100991696
   05204 Chemical carcinogenesis
    100991696
   05225 Hepatocellular carcinoma
    100991696
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100991696
  Drug resistance
   01524 Platinum drug resistance
    100991696
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100991696
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100991696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
22
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFQGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttatatcttt
gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac
ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg
gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc
cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc
cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg
gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt
cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaagtcttccaaggccgacccaagctggccacatggcggcagcgcgtggaggca
gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc
ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg
tga

DBGET integrated database retrieval system