KEGG   Pan paniscus (bonobo): 100991854Help
Entry
100991854         CDS       T02283                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
pps  Pan paniscus (bonobo)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100991854 (APOA4)
   04977 Vitamin digestion and absorption
    100991854 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 396 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAERMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LAFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcaccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattcggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacgtgcgagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcaacacgcaggccgagcagctgcggcgccagctgaccccctac
gcagagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgccgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctggccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagaccctctccctccccgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system