KEGG   Pan paniscus (bonobo): 100991867Help
Entry
100991867         CDS       T02283                                 

Gene name
ALPP
Definition
alkaline phosphatase, placental
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pps00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 534 aa AA seqDB search
MLGPCMLLLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIF
LGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAY
LCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGT
YAHTVNRNWYSDTNMPCSARREGCKDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPD
DYSQGGTRLDGKNLVQEWLAKHQGARYVWNHTELMQASLDPSVTHLMGLFEPGDMKYEIH
RDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIE
RAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGY
VLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIA
HVMAFAACLEPYTACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgggcctgaggctacagctctccctg
ggcatcatcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggcc
ctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttc
ctgggtgacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaag
aaggacaaactggggcctgagatccccctggccatggaccgcttcccatacgtggctctg
tccaagacatacaatgtagacaaacatgtgccagacagtggagccacagccacagcctac
ctgtgcggggtcaagggtaacttccagaccatcggcttgagtgcagccgcccgctttaac
cagtgtaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagca
gggaagtcagtgggagtggtaaccaccacacgggtgcagcacgcctcgccagccggcacc
tacgcccacacggtgaaccgcaactggtactcggacaccaacatgccttgctcggcccgc
cgggagggctgcaaggacatcgccacgcagctcatctccaacatggacattgacgtgatc
ctaggtggaggccgaaagtacatgtttcgcatggggaccccagaccctgagtacccagat
gactacagccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggca
aagcaccagggtgcccggtacgtgtggaaccacactgagctcatgcaggcttccctggac
ccgtctgtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccac
cgagactccacgctggacccctccctgatggagatgacagaggctgccctgcgcctgctg
agcaggaacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcat
catgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgag
agggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcc
cacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccct
ggcaaggcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctat
gtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgagtat
cggcagcagtcagcagtgcccctggacgaagagacccacgcaggcgaggacgtggcggtg
ttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcg
cacgtcatggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgcccccc
gccggcaccaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctg
ctggcagggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system