KEGG   Pan paniscus (bonobo): 100991867Help
Entry
100991867         CDS       T02283                                 

Gene name
ALPP
Definition
alkaline phosphatase, placental type
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100991867 (ALPP)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100991867 (ALPP)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100991867 (ALPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 534 aa AA seqDB search
MLGPCMLLLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIF
LGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAY
LCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGT
YAHTVNRNWYSDTNMPCSARREGCKDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPD
DYSQGGTRLDGKNLVQEWLAKHQGARYVWNHTELMQASLDPSVTHLMGLFEPGDMKYEIH
RDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIE
RAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGY
VLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIA
HVMAFAACLEPYTACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgggcctgaggctacagctctccctg
ggcatcatcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggcc
ctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttc
ctgggtgacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaag
aaggacaaactggggcctgagatccccctggccatggaccgcttcccatacgtggctctg
tccaagacatacaatgtagacaaacatgtgccagacagtggagccacagccacagcctac
ctgtgcggggtcaagggtaacttccagaccatcggcttgagtgcagccgcccgctttaac
cagtgtaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagca
gggaagtcagtgggagtggtaaccaccacacgggtgcagcacgcctcgccagccggcacc
tacgcccacacggtgaaccgcaactggtactcggacaccaacatgccttgctcggcccgc
cgggagggctgcaaggacatcgccacgcagctcatctccaacatggacattgacgtgatc
ctaggtggaggccgaaagtacatgtttcgcatggggaccccagaccctgagtacccagat
gactacagccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggca
aagcaccagggtgcccggtacgtgtggaaccacactgagctcatgcaggcttccctggac
ccgtctgtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccac
cgagactccacgctggacccctccctgatggagatgacagaggctgccctgcgcctgctg
agcaggaacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcat
catgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgag
agggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcc
cacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccct
ggcaaggcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctat
gtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgagtat
cggcagcagtcagcagtgcccctggacgaagagacccacgcaggcgaggacgtggcggtg
ttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcg
cacgtcatggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgcccccc
gccggcaccaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctg
ctggcagggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system