KEGG   Pan paniscus (bonobo): 100992024Help
Entry
100992024         CDS       T02283                                 

Gene name
CPB1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:pps04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:pps04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 417 aa AA seqDB search
MLALLVLVNVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKSHSTVDFRVKAEDTVTVENVLKQNELQYKVLINNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGHEIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRLWRKTRSTH
AGSSCIGTDPNRNFDAGWCEIGASQNPCAETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIQATCEETFLAIKYVASYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgctcttggttctggtgaatgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtgttaacgttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagattgacttctggaagccagattctgtcacacaa
atcaaatctcacagtacagttgacttccgtgttaaagcagaagatactgtcactgtggag
aatgttctaaagcagaatgaactacaatacaaggtactgataaacaacctgagaaatgtg
gtggaggctcagtttgatagccgggttcgtgcaacaggacacagttatgagaagtacaac
aagtgggaaacgatagaggcttggactcaacaagtcgccactgagaatccagccctcatc
tctcgcagtgttatcggaaccacatttgagggacgcgctatttacctcctcaaggttggc
aaagctggacaaaataagcctgccattttcatggactgtggtttccatgccagagagtgg
atttctcctgcattctgccagtggtttgtaagagaggctgttcgtacctatggacatgag
atccaagtgacagagcttctcgacaagttagacttttatgtcctgcctgtgctcaatatt
gatggctacatctacacctggaccaagagccgattatggagaaagactcgctccacccat
gctggatctagctgcattggcacagaccccaacagaaattttgatgctggttggtgtgaa
attggagcctctcaaaacccctgtgctgaaacttactgtggacctgctgcagagtctgaa
aaggagaccaaggccctggctgatttcatccgcaacaaactctcttccatcaaggcatat
ctgacaatccactcatactcccaaatgatgatctacccttactcatatgcttacaaactc
ggtgagaacaatgctgagttgaatgccctggctaaagctactgtgaaagaacttgcctca
ctgcacggcaccaagtacacatatggcccgggagctacaacaatctatcctgctgctggg
ggctctgacgactgggcttacgaccaaggaatcagatattccttcacctttgaacttcga
gatacaggcagatatggctttctccttccagaatcccagatccaggctacctgcgaggag
accttcctggcaatcaagtatgttgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system