KEGG   Pan paniscus (bonobo): 100992034Help
Entry
100992034         CDS       T02283                                 

Gene name
GSTT2B, GSTT2
Definition
(RefSeq) glutathione S-transferase theta 2B
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100992034 (GSTT2B)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100992034 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    100992034 (GSTT2B)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100992034 (GSTT2B)
   05225 Hepatocellular carcinoma
    100992034 (GSTT2B)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100992034 (GSTT2B)
  Drug resistance
   01524 Platinum drug resistance
    100992034 (GSTT2B)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100992034 (GSTT2B)
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100992034 (GSTT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
22
AA seq 244 aa AA seqDB search
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLIKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAIDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagagctgtttcttgacctggtgtcccagcccagccgcgccgtctacatcttc
gcgaagaagaatggcatccccttagagctgcgcaccgtggatcttatcaaagggcagcac
aagagcaaggagttcttgcagatcaacagcctggggaaactgccgacgctcaaggatggt
gatttcatcttgaccgaaagctcggccatcctgatttacctgagctgtaagtaccagacg
ccggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggc
tggcatgccgactgcatccgtggcacctttggtatacctctgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccgaggagaaggtggaacgcaacaggactgccatagac
caggccctgcaatggctggaggacaagttcctgggggacaggcccttccttgctggccag
caggtgacactggctgatctcatggctctggaggagctgatgcagccggtggctctcggc
tatgaactatttgagggacggccacgactggcagcatggcgtggacgagtggaggctttc
ctgggtgctgagctatgccaggaggcccacagcatcatcttgagcatcctggaacaggcg
gccaagaaaaccctcccaacaccctcaccagaggcctatcaggctatgctgcttcgaatc
gccaggatcccctga

DBGET integrated database retrieval system