KEGG   Pan paniscus (bonobo): 100992056Help
Entry
100992056         CDS       T02283                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00600  Sphingolipid metabolism
pps01100  Metabolic pathways
pps04020  Calcium signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04370  VEGF signaling pathway
pps04371  Apelin signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps05152  Tuberculosis
Module
pps_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100992056 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100992056 (SPHK2)
   04371 Apelin signaling pathway
    100992056 (SPHK2)
   04020 Calcium signaling pathway
    100992056 (SPHK2)
   04072 Phospholipase D signaling pathway
    100992056 (SPHK2)
   04071 Sphingolipid signaling pathway
    100992056 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100992056 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100992056 (SPHK2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100992056 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100992056
NCBI-ProteinID: XP_003814128
Position
19
AA seq 654 aa AA seqDB search
MNGHLETEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
QGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagcaggaccagaggccagaccaggagctgacc
gggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
caaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccccggttgcttctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggctggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacccgcctcgcccacccctgcccatagcctgcctcgtgccaagtcggag
ctgaccctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctcttcccctgccccagcctgccctggcctctcctggctcgccagaaccc
ctgcccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggct
ggggatgctccgctgtccccggacccactgctgtcttcacctcctggctctcccaaggca
gctctacactcacccgtctccgaaggggcccccgtaattcccccatcctctgggctccca
cttcccacccctgatgcccgggtaggggcctccacctgcggcccgcccgaccacctgctg
cctccgctgggcaccccgctgcccccagactgggtgacgctggagggggactttgtgctc
atgttggccatctcgcccagccacctaggcgctgacctggtggcagctccgcatgcgcgc
ttcgacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgctg
ctgcgccttttcttggccatggagcgtggtagccacttcagcctgggctgtccgcagctg
ggctacgccgcggcccgtgccttccgcctagagccgctcacaccacgcggcgtgctcaca
gtggacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcatcggt
acactgctcactgggcctcctggctgcccggggcgggagccctga

DBGET integrated database retrieval system