KEGG   Pan paniscus (bonobo): 100992056Help
Entry
100992056         CDS       T02283                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pps  Pan paniscus (bonobo)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pps00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:pps04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:pps04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:pps04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:pps05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 654 aa AA seqDB search
MNGHLETEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
QGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagcaggaccagaggccagaccaggagctgacc
gggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
caaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccccggttgcttctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggctggagcagtgaaccagcacgggggatttgagccagccctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacccgcctcgcccacccctgcccatagcctgcctcgtgccaagtcggag
ctgaccctaaccccagacccagccccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctcttcccctgccccagcctgccctggcctctcctggctcgccagaaccc
ctgcccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggct
ggggatgctccgctgtccccggacccactgctgtcttcacctcctggctctcccaaggca
gctctacactcacccgtctccgaaggggcccccgtaattcccccatcctctgggctccca
cttcccacccctgatgcccgggtaggggcctccacctgcggcccgcccgaccacctgctg
cctccgctgggcaccccgctgcccccagactgggtgacgctggagggggactttgtgctc
atgttggccatctcgcccagccacctaggcgctgacctggtggcagctccgcatgcgcgc
ttcgacgacggcctggtgcacctgtgctgggtgcgtagcggcatctcgcgggctgcgctg
ctgcgccttttcttggccatggagcgtggtagccacttcagcctgggctgtccgcagctg
ggctacgccgcggcccgtgccttccgcctagagccgctcacaccacgcggcgtgctcaca
gtggacggggagcaggtggagtatgggccgctacaggcacagatgcaccctggcatcggt
acactgctcactgggcctcctggctgcccggggcgggagccctga

DBGET integrated database retrieval system