KEGG   Pan paniscus (bonobo): 100992228Help
Entry
100992228         CDS       T02283                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pps00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 352 aa AA seqDB search
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctggcgtccgggtgcgcccggggcccgggccccggcgtgggcgcgcgt
cctgccgcagggctctttcacccggggcgccgccagagccgccaggcttccgacgcgccc
cggaaccagccccccagccccgagttcgtggcccggccggtgggcgtctgctccatgatg
cgcctgccggtgcagacctcccccgaggggctggacgctgccttcatcggggtgcccctg
gatactgggacctccaaccggcctggggcgagattcggacctcgccgcatccgggaagaa
tcagtgatgcttcggacagtcaatcctagcacgggggccctccccttccagtccctcatg
gttgcagacctaggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcga
attcaagaggcctatgagaaaattgtagcagctggctgtattcctctgaccttgggtgga
gatcacacaatcacatatcccatattgcaagcgatggcaaaaaagcatggcccagtgggg
ctgctgcatgtggacgcacacacggacacgaccgacaaggccctaggagagaagctctac
cacggggcgcccttccgccggtgtgtggatgagggtctcctggactgtaagcgtgtggtg
cagattggcatccggggctcttccacgaccttggatccctacagatacaaccggagccag
ggcttccgggtagtcctggctgaagactgctggatgaagtcgttggttcctctgatgggg
gaagtcaggcagcagatgggaggcaaacccatttatatcagctttgatattgacgctctg
gatcctgcctatgcgccagggacagggacacctgaaattgctggtctcactcctagtcag
gctctggagatcatcaggggttgtcaaggcctgaacgtggtgggctgtgatcttgtcgaa
gtttcaccaccgtatgatctttctgggaacacagccctgctggcggctaacctgctgttt
gagatgctgtgtgctctccccaaagtgacaaccgtctga

DBGET integrated database retrieval system