KEGG   Pan paniscus (bonobo): 100992308Help
Entry
100992308         CDS       T02283                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100992308 (PDK2)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100992308 (PDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 454 aa AA seqDB search
MTSRLAGRWNARQGKGREEAAEPRRWAERCASAARAGTTTQVAAAAAMRWVWALLKNASL
AGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINLLPD
RVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQG
VLEYKDAYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGSIDP
NCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELF
KNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPT
PQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPV
YNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccgattggctgggcgttggaatgcccgccagggcaagggtagggaggaggcg
gccgaaccgcgtcgctgggccgaaaggtgcgcgagcgctgcccgcgcggggaccacaacc
caagtcgcggccgccgcagccatgcgctgggtgtgggcgctgctgaagaatgcgtccctg
gcaggggcgcccaagtacatagagcacttcagcaagttctccccgtccccgctgtccatg
aagcagtttctggacttcggatccagcaatgcctgtgagaaaacctccttcaccttcctc
aggcaggagctgcctgtgcgcctggccaacatcatgaaagagatcaacctgcttcccgac
cgagtgctgagcacaccctctgtgcagctggtgcagagctggtatgtccagagcctcctg
gacatcatggagttcctggacaaggatcccgaggaccatcgcaccctgagccagttcact
gacgccctggtcaccatccggaaccggcacaacgacgtggtgcccaccatggcacaaggc
gtgcttgagtacaaggacgcctacggcgatgaccccgtctccaaccagaacatccagtac
ttcctggaccgcttctacctcagccgcatctccatccgcatgctcatcaaccagcacacc
ctcatctttgatggcagcaccaacccagcccatcccaaacacatcggcagcatcgacccc
aactgcaacgtctctgaggtggtcaaagatgcctacgacatggctaagctcctgtgtgac
aagtattacatggcctcacctgacctggagatccaggagatcaatgcagccaactccaaa
cagccgattcacatggtctacgtcccctcccacctctaccacatgctctttgagctcttc
aagaatgccatgagggcgactgtggaaagccatgagtccagcctcattctcccacccatc
aaggtcatggtggccttgggcgaggaagatctgtccatcaagatgagtgaccgaggtggg
ggtgttcccttgaggaagattgagcgactcttcagctacatgtactccacagcacccacc
ccccagcctggcactgggggaacgccgctggctggctttggttatgggctccccatttcc
cgcctctacgccaagtacttccagggagacctgcagctcttctccatggaaggctttggg
accgatgctgtcatctatctcaaggccctgtccacggactcggtggagcgcctgcctgtc
tacaacaagtcagcctggcgccactaccagaccatccaggaggccggcgactggtgtgtg
cccagcacggagcccaagaacacgtccacgtaccgcgtcagctaa

DBGET integrated database retrieval system