KEGG   Pan paniscus (bonobo): 100992361Help
Entry
100992361         CDS       T02283                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
pps  Pan paniscus (bonobo)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100992361 (RARB)
   05222 Small cell lung cancer
    100992361 (RARB)
   05223 Non-small cell lung cancer
    100992361 (RARB)
Transcription factors [BR:pps03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    100992361 (RARB)
Nuclear receptors [BR:pps03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100992361 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcaattgaaacacagagcaccagc
tctgaggaactcgtcccaagccccccatctccactccctccccctcgagtgtacaagccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaatatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccaatactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagttggacgatctt
acagagaagatccgaaaagctcaccaggaaactttcccttcactctgccagctgggtaaa
tacaccacgaattccagtgctgaccatcgagtccgtctggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcct
ggtttcactggcttgaccatcgcagaccaaattaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttctca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa
gtagataagctacaggaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgtagcatc
agtgctaaaggtgcagagcgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaagaaatgctggagaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagtggg
gtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system