KEGG   Pan paniscus (bonobo): 100992371Help
Entry
100992371         CDS       T02283                                 

Gene name
GSTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100992371 (GSTM3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100992371 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    100992371 (GSTM3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100992371 (GSTM3)
   05204 Chemical carcinogenesis
    100992371 (GSTM3)
   05225 Hepatocellular carcinoma
    100992371 (GSTM3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100992371 (GSTM3)
  Drug resistance
   01524 Platinum drug resistance
    100992371 (GSTM3)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100992371 (GSTM3)
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100992371 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 225 aa AA seqDB search
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFFKMPINNKMAQWGNKPVC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgctggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttgcagtctgatcagttcttcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

DBGET integrated database retrieval system