KEGG   Pan paniscus (bonobo): 100992392Help
Entry
100992392         CDS       T02283                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  translation initiation factor 4E
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps03013  RNA transport
pps04066  HIF-1 signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04211  Longevity regulating pathway
pps04910  Insulin signaling pathway
Module
pps_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100992392 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100992392 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100992392 (EIF4E2)
   04150 mTOR signaling pathway
    100992392 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100992392 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    100992392 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100992392 (EIF4E2)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100992392 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100992392 (EIF4E2)
Translation factors [BR:pps03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100992392 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100992392
NCBI-ProteinID: XP_003813192
Position
2B
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgctttgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagaatcagagc
agtagcaagagaaaggctgttgtccctggaccggcagagcatcccctgcagtacaactac
actttttggtactccaggagaacccccggccgtcccacgagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcctggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcctcccgttgctgggagaatctcattttggccatgctgggggaacagttc
atggttggggaggagatctgtggggctgtggtgtctgtccgctttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggacacactt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system