KEGG   Pan paniscus (bonobo): 100992707Help
Entry
100992707         CDS       T02283                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pps00562]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pps04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pps04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:pps04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:pps04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pps04919]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:pps05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1994 aa AA seqDB search
MVSEGSAAGRDFAGMEEVRQLHVRFCKGIKIWHQAWFLCSLLGREPQEREAGCQLWLCTL
SAVLKVGWLFPLSEVPNFTLLKDGCGCWRLKEDQIYNAVRREETENTVGSLLHFLTKLPA
SETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTFG
GSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYR
RVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWV
TWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDI
ETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASSLMKLCP
RYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLETDEEDS
PSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSRGSEDSQKAFDHGTELIPW
YVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPASSKAKL
GVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSMFLS
ETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYV
SLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKK
KILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANPPNPLPSRR
AHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGFQSFMV
SDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDENTSDLQ
PDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQ
LNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQ
ENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMP
IIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEK
LVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAYN
GGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIPKRIK
KADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGS
SRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPATSLSAI
IRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHG
IQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDP
AVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRV
HFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRM
EENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTN
EQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYVGRIV
LKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQT
LCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGA
GKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKP
VGGLSSSDTMDYRQ
NT seq 5985 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagaaggaagtgcagcaggaagagactttgcaggaatggaagaggtgaggcag
ctccatgtgagattctgcaaagggattaagatttggcaccaggcttggtttctgtgcagc
ctcttaggcagagagccccaggagagggaagcaggctgtcagctgtggctttgcacgctc
tcagctgtcttgaaggttggttggctcttcccgctctctgaggtacccaattttaccttg
ttaaaggatggatgtggatgctggaggcttaaagaagaccagatctacaatgcagtgaga
agagaagaaacagaaaatacagttggttctctactccatttcctcaccaagctcccagcc
tccgagacagcccatggaaggataagcgttggtccatgcttaaagcaatgtgtccgagac
actgtatgtgagtatcgcgccaccctccaaaggacttcaatatcgcagtacatcaccggt
tctctcctagaagcaaccacgtctttgggagcaagaagtggccttctcagtacttttgga
ggatccactggacgaatgatgctgaaagaacgccagccaggcccctctgtggccaattcc
aatgccctcccttcaagttcagctgggatcagcaaggagctgatcgatctgcagcctctc
atccagttcccagaggaagtcgccagcatcctgatggagcaagagcagactatttaccgc
agggtcttgccagtcgactacctttgcttcttaacacgggacttgggcactcctgaatgc
cagagctccttgccctgcctcaaagcatccatctcagcgtcgattcttaccactcagaat
ggagagcacaatgcccttgaagatctggtgatgaggtttaatgaggtgagctcctgggtg
acatggctgatcctcacggcaggctccatggaggagaagcgagaagtcttttcatatttg
gtgcatgtggccaaatgctgctggaacatgggcaactacaacgctgtcatggagttcttg
gctggcctcaggtcaagaaaagttttaaaaatgtggcagttcatggaccagtctgatatt
gagaccatgaggagcctgaaggatgctatggcccagcatgagtcctcttgtgagtacaga
aaggtggtgacacgtgccctgcacatccctggctgtaaggtggttccattctgtggggtg
tttctgaaggagctctgtgaagtgcttgacggcgcctccagcctcatgaagctttgccca
cggtacaattcccaagaagaaactttagagtttgtagcagattacagtggacaagataat
ttcttacaacgagtgggacaaaatggcttaaagaattcggagaaggagtccactgtcaac
agcatctttcaggtcatccggagctgcaatcgaagtctggagacagacgaggaggacagc
cccagtgaaggaaacagctccaggaaaagctccttgaaggataaaagccgatggcagttt
ataattggagatttgttggattcagacaatgacatctttgagcaatccaaagaatacgac
tctcgtggttcagaggattcacagaaggccttcgaccatgggacggagctcatcccttgg
tacgtgctgtccatccaagccgatgtgcaccagttcctgctgcagggggccacggtcatc
cactacgaccaggacacacacctctctgcccgttgcttcctccagcttcagcccgacaat
agcaccttgacctgggtaaagcccacaactgcctccccagccagcagtaaagcaaaactt
ggtgtacttaataacacagctgagcctggaaaattcccactactgggtaatgctggatta
agtagcctgacggaaggggtcttggatctttttgcagtgaaggctgtatacatgggccac
cctggcattgatatacacactgtgtgtgttcagaacaaactgggtagcatgttcctgtca
gagactggtgtgacattgctctatgggcttcagaccacagacaacagattattgcacttc
gtggcaccaaagcacacagctaaaatgctcttcagtggattattggaactcactagagct
gtgagaaagatgaggaaattccctgaccaaagacagcagtggctgcggaaacagtatgtc
agcctttatcaggaggatggacggtatgaaggcccaactttggctcacgctgtggagttg
tttggtggcagacggtggagtgctcgaaaccccagccccggaacatcagcaaagaatgct
gagaagcccaatatgcagagaaacaataccctgggcataagcactaccaagaaaaagaag
aaaatcctcatgaggggtgagagtggagaggtaactgacgatgagatggcaacccgaaag
gccaagatgcacaaagagtgtcgaagccggagtggttctgatcctcaagacattaatgaa
caagaagaatcagaggtgaatgccatcgctaaccctccaaaccccctcccttccagaaga
gcccactctttgaccacagctgggtcccccaacttggctgccgggacgtcatctcccatc
aggccagtgtcctcccctgtgctgtcttcttcaaacaagagcccatccagtgcttggagc
agtagtagctggcacgggcggatcaaaggcggcatgaagggatttcagagcttcatggtt
tcagatagcaacatgagttttgttgaatttgttgagctgttcaaatcgttcagtgtcagg
agccgcaaggacctgaaggatctgtttgatgtctatgcagtgccctgcaaccgatctggc
tctgagtcagccccactctacaccaacctgacaattgatgaaaacaccagcgatcttcag
cctgacctagatctgttgaccagaaatgtctcggatttggggttgttcattaagagtaaa
cagcagctatcggacaaccagaggcagatatctgatgccattgctgctgcaagcattgtg
acaaatggcactgggattgagagcacatctctgggcatttttggggtgggcatacttcag
ctcaacgatttcctcgtgaattgccaaggagaacactgcacttatgatgaaatcctcagc
atcatccagaagttcgagcctagcatcagtatgtgtcatcagggactaatgtcatttgaa
gggtttgccaggtttctgatggataaagaaaattttgcctcaaaaaatgatgagtcacag
gagaacattaaagaactgcagctacccctctcatactattacatcgaatcttcgcacaat
acctacctcacgggccatcagctcaaaggagaatcctcggtagaactctacagccaggtc
cttttgcaaggctgtcgaagtgtagaattggactgctgggacggagacgatgggatgccc
atcatttatcatggacatacgctgacaaccaagatccccttcaaggaagtggttgaagcc
attgatcgcagtgccttcatcaactctgacctgccaatcatcatatcgattgagaaccac
tgttcattgcctcagcaacgaaaaatggcagaaattttcaagactgtgtttggagaaaag
ctggtgactaaattcttatttgagactgatttttcagatgatccaatgcttccttcacct
gaccaactcagaaagaaagttcttcttaaaaacaagaagctaaaagcccatcagacgcca
gtggatatcttaaagcaaaaggctcatcagttagcatctatgcaagcgcaggcttataat
ggtgggaatgccaaccccccacctgccaataatgaggaagaggaagatgaggaggacgaa
tatgattatgactatgaatccctttctgatgacaacattctggaagacagacctgaaaat
aaatcatgtaatgacaagcttcagtttgaatataatgaagaaatcccaaagaggataaag
aaagcagataactctgcttgcaacaaaggaaaggtttatgatatggaactgggagaagaa
ttttatcttgatcagaataaaaaggaaagcagacagattgcaccagagctttctgacctt
gtaatctattgtcaagcagtaaaatttccaggactgtcaactctaaatgcatctggctct
agcagaggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggcagaatg
agcccaggggagacagcatcatttaacaaaacatctggaaaaagttcctgtgaaggcatt
cgacagacctgggaggaatcttcttcccctctcaacccagccacgtccctcagtgctatc
attagaactcccaaatgttatcatatctcgtcgctgaatgaaaatgccgccaaacgtctg
tgtcgcaggtattctcagaaactgatccagcacaccgcctgtcagctgctgagaacttac
cctgctgccacccgcatcgactcttccaacccgaaccccctcatgttctggctccatggg
atacagctcgtggcactcaactaccagaccgatgatctccctttacatttaaatgctgca
atgtttgaggcaaatggtggttgtggttatgttttgaaacctccagttctgtgggacaag
aactgccccatgtatcagaagttttctccactagaaagagatctggacagcatggatcct
gcagtctattctttaactattgtctctggtcagaatgtgtgccccagtaatagcatggga
agcccgtgcattgaagtcgacgtcctgggcatgcctctggacagctgccatttccgcaca
aagcccatccatcgaaacaccctgaaccccatgtggaacgagcagtttctgttccgcgtt
cacttcgaagatcttgtatttcttcgttttgcagttgtggaaaacaatagttcagcggta
actgctcagagaatcattccactgaaagctttaaaacgaggatatcgacatcttcagctg
cgaaaccttcacaatgaagtcttggagatttctagtttattcattaacagcagaaggatg
gaagaaaattcctctggcaataccatgtcagcctcttcgatgtttaatacagaagaaaga
aaatgtttgcagactcacagagtcacggtgcatggggtcccagggccagagccctttacc
gttttcactattaatggaggcaccaaggcaaagcagcttctgcagcaaattctgacaaat
gaacaagacatcaaacctgttaccacagactattttttgatggaagaaaaatattttata
tctaaagaaaagaatgaatgtaggaaacaaccattccagagagccattggtccagaagag
gagatcatgcaaattttaagcagctggtttccagaagagggatacgtgggcaggattgtc
ttaaaaacccagcaggaaaacctagaagagaaaaacattgttcaagatgacaaagaggtg
atcttgagctcagaggaggagagtttctttgtccaagtgcatgatgtttctccagagcaa
cctcgaacagtcatcaaagcaccccgcgtcagcactgcacaggatgtcattcagcagacc
ttatgcaaagccaaatattcctacagcatcctgagcaaccccaatccaagcgactatgtg
cttttggaagaggtggtgaaagacactaccaacaagaagaccaccacaccaaagtcctct
cagcgggtccttctggatcaggagtgtgtgtttcaagcccaaagcaagtggaaaggtgca
ggaaaattcatccttaagctaaaggagcaggtgcaggcatctcgagaagataaaaagaaa
ggcatttctttcgcaagtgaactcaagaagctcaccaagtcaactaaacagccccgagga
cttacatcaccttctcagctcttgacctcagaaagtatccaaaccaaggaggagaaacct
gtgggtggcttgtcctccagtgacacaatggattaccgacagtga

DBGET integrated database retrieval system