KEGG   Pan paniscus (bonobo): 100992721Help
Entry
100992721         CDS       T02283                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
pps  Pan paniscus (bonobo)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100992721 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100992721 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100992721 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    100992721 (ALOX12)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100992721 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
17
AA seq 782 aa AA seqDB search
MFAPTRGLRPTSIPPSREVQEGPAAPTPLASPWLGPLYHPAATLRPGGTASPRSRLYRSA
RRFGLVWGGDLGAPKTCEEGGAADRSFKGWKWPRGAGSPGRSRESHRTRLPSPKLLGGAM
GRYRIRVATGAWLFSGSYNRVQLWLVGARGEAELELQLRPARGEEEEFDHDVAEDLGLLQ
FVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNAL
DVFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAG
ALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFGYQFLNGANPMLL
RRSTSLPCRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLI
MLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHL
LNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTG
GGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYARDALRLWEIIARYVEGIVHL
FYQRDDVVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHA
AINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQ
PDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSV
TI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctccaacccgggggctcaggcccacctcgatcccgccttcccgggaggtccag
gaaggtcccgccgcacccaccccgttggcctcaccctggctcgggcccctttatcatcct
gcagctacgctccgaccaggaggcacagccagtccccgcagccggctctaccgctctgct
cgcaggtttgggctagtctggggcggggacttgggagcgcctaaaacttgcgaggagggc
ggggccgcagaccggtcctttaaaggttggaagtggccccgaggcgccggcagccctggg
cggtcccgggaatcgcacaggacccggctcccctcgcctaagctgctggggggcgccatg
ggccgctaccgcatccgcgtggccaccggggcctggctcttctccgggtcgtacaaccgc
gtgcagctttggctggtcggggcgcgcggggaggcggagctggagctgcagctgcggccg
gcgcggggcgaggaggaggagtttgatcatgacgttgcagaggacttggggctcctgcag
ttcgtgaggctgcgcaagcaccactggctggtggacgacgcgtggttctgcgaccgcatc
acggtgcagggccctggagcctgcgcggaggtggccttcccgtgctaccgctgggtgcag
ggcgaggacatcctgagcctgcccgagggcaccgcccgcctgccaggagacaatgctttg
gacgtgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgctgg
gccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatgatctacct
ccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaaggcaggg
gctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgcctagaa
gactttgatcagatcttctggggccagaagagtgccctggctgagaaggttcgccagtgc
tggcaggatgatgagttgttcggctaccagttcctcaatggtgccaaccccatgctgttg
agacgctcgacctctctgccctgcaggctagtgctgccctcggggatggaagagcttcgt
gctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatccttctg
gatggaattccagccaacgtgatccgaggagagaagcaatacctggctgcccccctcatt
atgctgaagatggagcccaatgggaagctgcagcccatggtcatccagattcagcctccc
aaccccagctctccaaccccaacactgttcctgccctcagaccccccacttgcctggctc
ctggcaaagtcctgggtccgaaattcagatttccaactgcacgagatccagtatcactta
ctgaacactcatctggtggctgaggtcatcgctgtcgccaccatgcggtgcctcccagga
ctgcaccccatcttcaagttcctgatcccccatatccgctacaccatggaaatcaacacc
cgggcccggacccaactcatctcagatggaggaatttttgataaggcagtgagcacaggt
ggagggggccatgtacagttgctccgtcgggcggcagctcagctgacctactgctccctc
tgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctatgcc
cgtgatgctttacggctctgggagatcattgccaggtatgtggaggggatcgtccacctc
ttctaccaaagggatgacgtagtgaagggggaccctgagctgcaggcctggtgtcgggag
atcacggaggtggggctgtgccaggcccaggaccgaggtttccctgtctcctttcagtcc
cagagtcaactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcatgcc
gccatcaaccagggccagctggactggtatgcctgggtccctaatgctccatgcacaatg
cggatgcccccacccaccaccaaggaagatgtaacgatggccacagtgatggggtcacta
cctgatgtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgccag
ccagacatggtgcctctggggcatcacaaagaaaaatatttctcaggccccaagcccaaa
gctgtgctaaaccaattccgaacagatttggaaaagctggaaaaggagattacagcccgg
aatgagcaacttgactggccctatgaatatctgaagcccagctgcatagagaacagtgtc
accatctga

DBGET integrated database retrieval system