KEGG   Pan paniscus (bonobo): 100992733Help
Entry
100992733         CDS       T02283                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100992733 (FLNB)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100992733 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100992733 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100992733 (FLNB)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100992733 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTVKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSNMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIMGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctggctgaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctggtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctgggagccctggtagacagctgtgctcca
ggtctttgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacataaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgagtgttgacaaggcccagggagatgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacctacttcgacatctat
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggccctcacgtggtcaaggtcttctttgctggggacactattcctaagagt
cccttcattgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccgtgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcagcggacttcgtggtggaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgatgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggagactacaaccctgatctggttcgagcatacgggccaggtttggagaaatctgggtgc
attgtcaacaacctggccgagttcaccgtggatcctaaggatgctgggaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcgtgctcatacaccccagtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacggtggactgtactgaggctggggaaggtgatgtcagtgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacggtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccaccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtgtacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatatcatcgat
aattatgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
agcagcacggccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
accaaggtgaaggcccatggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgtgaggccaaaatcgagtgctccgacaatggtgacgggacctgctccgtctcttacctt
cccacaaaacccggggagtactttgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagctgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcatgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccaggggccctgggcctggaagctgtctcggactcgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaactcgtgccacacttccccgcccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccgggaatagaaggg
aaagatgtgttccgggaagctaccaccgactttacggttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgctgatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgatgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccaaccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggcgcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccgggggattacgatgttaatatcaca
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggtcctg
ggcccacgaggcctggtggagccagtgaacgtggtggacaatggagatggcacacacaca
gtaacctacaccccatctcaggagggaccttacatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaattgatgcccgagatgccggggaaggcctgcttgctgttcaaataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccccgacaagactgggcgctatatgattggggtcacctacgggggtgacgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaaggggaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcattgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccgggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtaacatgaac
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggagaggtccacatgccttctgggaagacagccacacctgagattgtggacaacaag
gacggcacggtcactgttagatacgcccccactgaggtcgggctccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctacgtgaactaccccaac
agtggaagtgtttctgcatacggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgccgactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcagccgctgacttcctgctcgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagacgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggcgaacatctggtcagcatcaagaaa
aatggcaaccatgtggccaacagccccgtgtccatcatggtggtccagtccgagatcggt
gacgcccgccgagccaaagtctatggccgcggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcagtggaa
ggccccagcaaagtggacatccagacggaggacctggaagatggcacctgcaaagtctcc
tacttccccaccgtgcctggggtttatatcgtctccaccaaattcgctgacgagcacgtg
cctgggagcccatttaccgtgaagatcagcggggagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtccgtggccactgttgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaggcagagattgtgcccatggggaagaactcacactgcgtccgatttgtgccccag
gagatgggcgtgcacacggtcagcgtcaagtaccgtgggcagcacgtcaccggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggtgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggcgctggaggcctctccatcgctgttgagggccccagtaaggccgagattacattc
gatgaccataaaaatgggtcgtgcggtgtatcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacatcccggaaagcccctacctggtgccggtc
atcgcaccctccgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcatccctcatgagaatggtgtccacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcctggacaa
gcggggaaccctgccctggtgtccgcctatggcgcgggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccagggacattatccgtcacc
atcgaaggcccatccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcagcgtcaaatacggtgggcccaac
cacatcatgggcagtcccttcaaggccaaggtgacaggccagcgtctagttagccccggc
tcagccaacgagacctcatccatcctggtggagtcagtgaccaggtcttctacagagacc
tgctatagcgccattcccaaggcatcctcggacgccagcaaggtgacctctaagggggca
gggctctcaaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctcc
atgaagcatgtaggcaaccagcaatacaacgtcacatacgtcgtcaaggagaggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

DBGET integrated database retrieval system