KEGG   Pan paniscus (bonobo): 100992962Help
Entry
100992962         CDS       T02283                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pps03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 838 aa AA seqDB search
MSLQVLNDKNVSHEKNTENCDFLFSPPEVTGRSSVLHVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPTSETLEDPCRTESQHKAETPHRAEEECKAETPHGAEEECRHGG
VCAPTAVATSPPGAIPKEACGGAPLQGLPGEALACPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAARQQKAPQEVEEDDSRSGAGEDPPMPASRGSYHLDWDKMDDPNFSPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLSAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPVSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPHRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagccatgaaaaaaatacagaaaattgc
gacttcctgttttcgccaccagaagttaccggaagatcgtctgttcttcatgtgtcacag
aaagaaaatgtgccacccaagaacctggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttcactcaggatgacacccttggactggaaaactcacacccggtctggacacagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacaccgacctcctgggggatgcaagcccagcctttgggagtggcagc
tccagcgagtctggccccggtgccctggctgacctggactgctcaagctcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccaggaaaagtgtctggcagccctgagcaa
gccgtggaggaaaaccttagttcctattccttagacagaagagtgacacccacctctgag
accctagaagacccttgcaggacagagtcccagcacaaagcggagactccgcaccgagcc
gaggaagaatgcaaagcggagactccgcacggagccgaggaagaatgccggcacggtggg
gtctgtgctcccacagcagtggccacttcgcctcctggtgcaattcctaaggaagcctgc
ggaggagcacccctgcagggtctgcctggcgaagccctggcctgccctgcgggtgtgggc
acccccgtgccagcagatggcactcagacccttacctgtgcacacacctctgctcctgag
agcacagccccaaccaaccacctggtggctggcagggccatgaccctgagtcctcaggaa
gaagtggccgcaggccaaatggccagctcctcgaggagcggacccgtaaaactagaattt
gatgtatctgatggcgccaccagcaaaagggcacccccaccaaggagactgggagagagg
tccggcctcaagcctcccttgaggaaagcagcagcgaggcagcaaaaggccccgcaggag
gtggaggaggatgacagtaggagcggagcgggagaggacccccccatgccggcttctcgg
ggctcttaccacctcgactgggacaaaatggatgacccaaacttcagcccgttcggaggt
gacaccaagtctggttgcagtgaggcccagcccccagaaagccctgagaccaggctgggc
cagccagcggctgaacagctgagtgctgggcctgccacggaggagccaggtccctgtctg
agccagcagctgcattcagcctcagcggaggacacgcctgtggtgcagttggcagccgag
accccaacagcagagagcaaggagagagccttgaactctgccagcacctcgcttcccaca
agctgtccagtcagtgagccagtgcccacccatcagcaggggcagcctgccttggagctg
aaagaggagagcttcagagaccccgctgaggttctaggcacgggcgcggaggtggattac
ctggagcagtttggaacttcctcgtttaaggagtcagccttgaggaagcagtccttatac
ctcaagttcgaccccctcctgagggacagtcctcatagaccagtgcccgtggccaccgag
accagcagcatgcacggtgcaaatgagactccctcaggacgtccgcgggaagccaagctt
gtggagttcgatttcttgggagcactggacattcctgtgccaggcccacccccaggtgtc
cccgcacctgggggcccacccctgtccaccggacctatagtggacctgctccagtacagc
cagaaggacctggatgcagtggtaaaggcgacacaggaggagaaccgggagctgaggagc
aggtgtgaggagctccacgggaagaacctggaactggggaagatcatggacaggttcgaa
gaggttgtgtaccaggccatggaggaagttcagaagcagaaggaactttccaaagctgaa
atccagaaagttctaaaagaaaaagaccaacttaccacagatctgaactccatggagaag
tccttctccgacctcttcaagcgttttgagaaacagaaagaggtgatcgagggctaccgc
aagaacgaagagtcactgaagaagtgcgtggaggattacctggcgaggatcacccaggaa
ggccagaggtaccaagccctgaaggcccacgcggaggagaagctgcagctggcaaacgag
gagatcgcccaggtccggagcaaggcccaggcggaagcgttggccctccaggccagcctg
aggaaggagcagatgcggatccagtcgctggagaagacagtggagcagaagactaaagag
aacgaggagctgaccaggatctgcgacgacctcatctccaagatggagaagatctga

DBGET integrated database retrieval system