KEGG   Pan paniscus (bonobo): 100993077Help
Entry
100993077         CDS       T02283                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pps04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pps04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pps04010]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:pps04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACMGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKTLILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagttggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccggcggcacagcagcctaatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctacagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcgacaggcaactatggcaactaccggcgtcggctggcagcctgtatgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtgctggaggagtggacctcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctatttcctgcgctccagctctgtgttggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccccgtcgcctgccgccactgcaaaaccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccacgcacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system