KEGG   Pan paniscus (bonobo): 100993104Help
Entry
100993104         CDS       T02283                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase subunit beta
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100993104 (P4HB)
Enzymes [BR:pps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100993104 (P4HB)
Chaperones and folding catalysts [BR:pps03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100993104 (P4HB)
Membrane trafficking [BR:pps04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100993104 (P4HB)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100993104 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100993104 (P4HB)
  Exosomal proteins of bladder cancer cells
   100993104 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 ERp29_N Thioredoxin_8 AhpC-TSA Redoxin HyaE Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 100993104
NCBI-ProteinID: XP_003831156
Position
17
AA seq 508 aa AA seqDB search
MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDSKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERIAEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEXKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctgtgcctggccgtggccgccctggtgcgcgccgacgccccc
gaggaggaggaccacgtcctggtgctgcggaaaagcaacttcgcggaggcgctggcggcc
cacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctggcc
cctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcaggttggcc
aaggtggacgccacggaggagtctgacctggcccagcagtacggcgtgcgcggctatccc
accatcaagttcttcaggaatggagacacggcttcccccaaggaatatacagctggcaga
gaggctgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccaccaccctg
cctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcatcggcttc
ttcaaggacgtggagtcggactctgccaagcagtttttgcaggcagcagaggccatcgat
gacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctcgacaaa
gatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggggaggtc
accaaggagaacctgctggactttatcaaacacaaccagttgccccttgtcatcgagttc
accgagcagacagccccgaagatttttggaggtgaaatcaagactcacatcctgctgttc
ttgcccaagagtgtgtctgactatgacagcaaactgagcaacttcaaaacagcagccgag
agcttcaagggcaagatcctgttcatcttcatcgacagcgaccacaccgacaaccagcgc
atccttgagttctttggcctgaagaaggaagagtgcccggccgtgcgcctcatcaccctg
gaggaggagatgaccaagtacaagcccgaatcggaggagctgacggcagagaggatcgca
gagttctgccaccgcttcctggagggcaaaatcaagccccacctgatgagccaggagctg
ccggaggactgggacaagcagcctgtcaaggtgcttgttgggaagaactttgaagacgtg
gcttttgatgagnaaaaaaacgtctttgtggagttctatgccccatggtgtggtcactgc
aaacagttggctcccatttgggataaactgggagagacgtacaaggaccatgagaacatc
gtcatcgccaagatggactcgactgccaacgaggtggaggccgtcaaagtgcacagcttc
cccacactcaagttctttcctgccagtgctgacaggacggtcatcgattacaacggggaa
cgcacgctggatggttttaagaagttcctggagagcggtggccaggatggggcaggggat
gatgatgatctcgaggacctggaagaagcagaggagccagacatggaggaagatgatgat
cagaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system