KEGG   Pan paniscus (bonobo): 100993245Help
Entry
100993245         CDS       T02283                                 

Gene name
AMY1A
Definition
alpha-amylase 1
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100993245 (AMY1A)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100993245 (AMY1A)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100993245 (AMY1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 367 aa AA seqDB search
MKFFWLLFTIGFCWARYSPNTQQGRTSIVHPFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNVDXFRNMVTRCNNVGVRIYVHAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDSENYNDATQVRYCHLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKLSYLKNREEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYEMAVGXMLAHPYGFTRVMSSYRWP
RYFENGK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcttttggttgcttttcaccattgggttctgctgggctcggtattccccaaat
acacaacaaggacggacatctattgttcatccgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggcgttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgtagattaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtgcatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatagcgagaactataatgatgctactcaggtcagatattgtcatctgtctggtctt
cttgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttcccggaaggt
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagttgtcttacttaaagaaccgggaagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcaaagaggacat
ggggctggaggagcctctatacttaccttctgggatgctaggctttatgaaatggcagtt
gganttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaa

DBGET integrated database retrieval system