KEGG   Pan paniscus (bonobo): 100993315Help
Entry
100993315         CDS       T02283                                 

Gene name
GSTM5
Definition
(RefSeq) glutathione S-transferase Mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00480  Glutathione metabolism
pps00980  Metabolism of xenobiotics by cytochrome P450
pps00982  Drug metabolism - cytochrome P450
pps00983  Drug metabolism - other enzymes
pps01524  Platinum drug resistance
pps05200  Pathways in cancer
pps05204  Chemical carcinogenesis
pps05225  Hepatocellular carcinoma
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100993315 (GSTM5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100993315 (GSTM5)
   00982 Drug metabolism - cytochrome P450
    100993315 (GSTM5)
   00983 Drug metabolism - other enzymes
    100993315 (GSTM5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100993315 (GSTM5)
   05204 Chemical carcinogenesis
    100993315 (GSTM5)
   05225 Hepatocellular carcinoma
    100993315 (GSTM5)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100993315 (GSTM5)
  Drug resistance
   01524 Platinum drug resistance
    100993315 (GSTM5)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100993315 (GSTM5)
Transporters [BR:pps02000]
 Other Transporters
  Pores ion channels [TC:1]
   100993315 (GSTM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 100993315
NCBI-ProteinID: XP_003810692
Position
1
AA seq 218 aa AA seqDB search
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAQKITQSNAILRYIAHKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF
EKLKPKYLEELPEKLKLYSEFLGKQPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLN
LKDFISRFEGLKKISAYLKSSQFFRGLLFGKSATWNSK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgactctggggtactgggacatccgcgggctggcccacgccatccgcttgctc
ctggaatacacagactcaagctatgtggaaaagaagtacacgctgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcagaagatcacccagagcaatgccatcctgcgctacatt
gcccacaagcacaacctatgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggttatggataaccacatggagctggtcagactgtgctatgacccagatttt
gagaaactgaagccaaaatacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcagccatggtttgcaggagacaagatcacctttgtggatttccttgcc
tacgatgtccttgacatgaagcgtatatttgagcccaagtgcttggatgccttcctaaac
ttgaaggacttcatctcccgctttgagggtttgaagaagatctctgcctacttgaagtcc
agccaattcttccgaggtcttttgtttggaaagtcagctacatggaacagcaaatag

DBGET integrated database retrieval system