KEGG   Pan paniscus (bonobo): 100993402Help
Entry
100993402         CDS       T02283                                 

Gene name
CES5A
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100993402 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 575 aa AA seqDB search
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFMNPQPASPWDNLREATSYPNLCFQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYAPAHADAGSKLPVLVWFPGGAFKTGSASIFDGSALAAYEDVLVVVVQYRLGIF
GFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPM
AKGLFHKAIMESGVAIIPYLKAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILS
GSNKSLALHLIQNILHIPPQYLHLVADEYFHDKHSLTEIRDTLLDLLGDVFFVVPALITA
RYHRDAGAPVYFYEFRHRPQCFEDTKPAFVKADHADEVRFVFGGAFLKGDIVMFEGATEE
DKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVEFWT
RTXPLILSASDTLHSPLSSLTFLSLLQPFFFSCAP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaattgggtgcacccaggccagatcctaatttgggctatctgggtccttgca
gcccccaccaaagggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcaccgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggatccctgcgatttatgaacccgcagcctgcatcgccc
tgggataacttgcgagaagccacctcctaccctaatttgtgcttccagaactcagagtgg
ctgctcttagatcagcacatgctcaaggtgcattaccccaaattcggcgtgtcagaagac
tgcctctatctgaacatctatgcgcctgcccacgccgatgcaggctccaagctccccgtc
ttggtgtggttcccaggaggtgccttcaagactggctcagcctccatctttgatgggtcc
gccctggctgcctatgaggacgtgctggttgtggtcgtccagtaccggctaggaatattt
ggtttcttcaccacatgggatcagcacgctccggggaactgggccttcaaggaccaggtg
gctgctctgtcctgggtccagaagaacatcgagttcttcggtggggaccccagctctgtg
accatctttggcgagtccgcgggagccataagtgtttctagtcttatactgtctcccatg
gccaaaggcttattccacaaagccatcatggagagtggggtggccatcatcccttacctg
aaggcccatgattatgagaagagtgaggacctgcaggtggttgcacatttctgtggtaac
aatgcgtcagactctgaggccctgctgaggtgcctgaggacaaaaccctccaaggagctg
ctgaccctcagccagaaaacaaagtctttcactcgagtggttgatggtgctttctttcct
aatgagcctctagatctattgtctcagaaagcatttaaagcaattccttccatcatcgga
gtcaataaccacgagtgtggcttcctgctgcctatgaaggaggctcctgagatcctcagt
ggctccaacaagtcccttgccctccatctgatacaaaacatcctgcacatcccgcctcag
tatttgcaccttgtggctgatgaatacttccatgacaagcactccctgactgaaatccga
gacactcttctggacttgcttggagatgtgttctttgtggtccctgcactgatcacagct
cgatatcacagagatgctggtgcacctgtctacttctatgagtttcggcaccggcctcag
tgctttgaagacacgaagccagcttttgtcaaagctgaccacgctgatgaagtccgcttt
gtgttcggtggtgccttcctgaagggtgacattgttatgttcgaaggagccacggaggag
gacaagttactgagccggaagatgatgaaatactgggctacctttgctcgaaccgggaat
cctaatgggaacgacctgtctctgtggccagcttataatctgactgagcagtacctgcag
ctggacttgaacatgagcctcggacagagactcaaagaaccgcgggtggagttttggacc
agaaccnatccactgatcctgtctgcctccgacacgctccacagtcctctttcttcctta
actttcctctctctcctccagcctttctttttctcttgtgctccttga

DBGET integrated database retrieval system