KEGG   Pan paniscus (bonobo): 100993510Help
Entry
100993510         CDS       T02283                                 

Gene name
PFKL
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100993510 (PFKL)
   01230 Biosynthesis of amino acids
    100993510 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100993510 (PFKL)
   00030 Pentose phosphate pathway
    100993510 (PFKL)
   00051 Fructose and mannose metabolism
    100993510 (PFKL)
   00052 Galactose metabolism
    100993510 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100993510 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100993510 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100993510 (PFKL)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100993510 (PFKL)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100993510 (PFKL)
Messenger RNA biogenesis [BR:pps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100993510 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 751 aa AA seqDB search
MNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTIIGSARC
KAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELVAEGKISETT
ARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMG
RHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDR
NGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATP
DTPACVVTLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLA
HQKPPKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISHGHTVYVVHDGFEGLAKGQVQE
VGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIHALLVVGGFEAYEGVLQLVE
ARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFIV
ETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNEK
CHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEK
LREVYRKGRVFANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLK
MLAQYRISMAAYVSGELEHVTRRTLSMDKGF
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgctgtccgggctgtgacgcgcatgggcatttatgtgggtgccaaagtcttc
ctcatctacgagggctatgagggcctcgtggagggaggtgagaacatcaagcaggccaac
tggctgagcgtctccaacatcatccagctgggcggcactatcattggcagcgctcgctgc
aaggcctttaccaccagggaggggcgccgggcagcggcctacaacctggtccagcacggc
atcaccaacctgtgcgtcatcggcggggatggcagcctcacgggtgccaacatcttccgc
agcgagtggggcagcctgctggaggagctggtggcggaaggtaagatctcagagactacg
gcccggacctactcgcacctgaacatcgcgggcctagtgggctccatcgataacgacttc
tgcggcaccgacatgaccattggcacggactcggccctccaccgcatcatggaggtcatc
gatgccatcaccaccactgcccagagccaccagaggaccttcgtgctggaagtgatgggc
cggcactgcgggtacctggcgctggtatctgcactggcctcaggggccgactggctgttc
atccccgaggctccacccgaggacggctgggagaacttcatgtgcgagaggctgggtgag
actcggagccgtgggtcccgactgaacatcatcattatcgctgagggtgccattgaccgc
aacgggaagcccatctcgtccagctacgtgaaggacctggtggttcagaggctgggcttc
gacacccgtgtaactgtgctgggccacgtgcagcggggagggacgccctctgccttcgac
cgaatcctgagcagcaagatgggcatggaggcggtgatggcgctgctggaagccacgcct
gacacgccagcctgcgtggtcaccctctcggggaaccagtcagtgcggctgcccctcatg
gagtgtgtgcagatgaccaaggaagtgcaaaaagccatggatgacaagaggtttgacgag
gccacccagctccgtggcgggagcttcgagaacaactggaacatttacaagctcctcgcc
caccagaagccccctaaggagaagtctaacttctccctggccatcctgaatgtgggggcc
ccggcggctggcatgaatgcggccgtgcgctcggcggtgcggaccggcatctcccacgga
cacacagtatacgtggtgcacgatggcttcgaaggcctagccaagggtcaggtgcaagaa
gtgggctggcacgacgtggccggctggttggggcgtggtggctccatgctggggaccaag
aggaccctgcccaagggccagctggagtccatcgtggagaacatccgcatctatggtatt
cacgccctgctggtggtcggcgggttcgaggcctatgaaggggtgctgcagctggtggag
gctcgcgggcgctacgaggagctctgcatcgtcatgtgtgtcatcccagccaccatcagc
aacaacgtccctggcaccgacttcagcctgggctctgacactgctgtaaatgccgccatg
gagagctgtgaccgcatcaaacagtccgcctcggggaccaagcgccgtgtgttcatcgtg
gagaccatggggggttactgtggctacctggccaccgtgactggcattgctgtgggggcc
gacgccgcctacgtcttcgaggaccctttcaacatccatgacttaaaggtcaacgtggag
cacatgacggagaagatgaagacagacattcagaggggcctggtgctgcggaacgagaag
tgccatgactactacaccacagagttcctgtacaacctgtactcatcagagggcaagggt
gtgttcgactgcaggaccaacgtcctgggccacctgcagcagggtggcgctccaaccccc
tttgaccggaactacgggaccaagctgggggtgaaggccatgctgtggttgtcggagaag
ctgcgcgaggtttaccgcaagggacgggtgttcgccaatgccccagactcggcctgcgtg
atcggcctgaagaagaaggcggtggccttcagccccgtcactgagctcaagaaagatact
gatttcgagcaccgcatgccacgggagcagtggtggctgagcctgcggctcatgctgaag
atgctggcacaataccgcatcagtatggccgcctacgtgtcaggggagctggagcacgtg
acccgccgcaccctgagcatggacaagggcttctga

DBGET integrated database retrieval system