KEGG   Pan paniscus (bonobo): 100993628Help
Entry
100993628         CDS       T02283                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
pps  Pan paniscus (bonobo)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100993628 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 334 aa AA seqDB search
MERKISRIHLASEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQ
TDPSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKEKPD
SSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaaataagcagaatccatctcgcttctgaacccagtataactcattttcta
caagtatcttgggagaaaacactggaatctggttttgttattacacttactgatggtcat
tcagcatggactgggacagtttctgaatcagagatttcccaagaagctgatgacatggca
atggaaaaagggaaatatgttggtgaactgagaaaagcattgttgtcaggagcaggacca
gctgatgtatacacgtttaatttttctaaagagtcttgttatttcttctttgagaaaaac
ctgaaagatgtctcattcagacttggttccttcaacctagagaaagttgaaaacccagct
gaagtcattagagaacttatttgttattgcttggacaccattgcagaaaatcaagccaaa
aatgagcacctgcagaaagaaaatgaaaggcttctgagagattggaatgatgttcaagga
cgatttgaaaaatgtgtgagtgctaaggaagctttggagactgatctttataagcggttt
attctggtgttgaatgagaagaaaacaaaaatcagaagtttgcataataaattattaaat
gcagctcaagaacgagaaaaggacatcaaacaagaaggggaaactgcaatctgttctgaa
atgactgctgaccgagatccagtctatgatgagagtactgatgaggaaagtgaaaaccaa
actgatccctctgggttggcttcagctgctgtaagtaaagatgattccattatttcaagt
cttgatgtcactgatattgcaccaagtagaaaaaggagacagcgaatgcaaagaaatctt
gggacagaacctaaaatggctcctcaggagaatcagcttcaagaaaaggaaaagcctgat
tcttcactacctgagacgtcgaaaaaggagcacatctcagctgaaaacatgtctttagaa
actctgagaaacagcagcccagaagacctctttgatgagatttaa

DBGET integrated database retrieval system