KEGG   Pan paniscus (bonobo): 100993672Help
Entry
100993672         CDS       T02283                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
pps  Pan paniscus (bonobo)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100993672 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2217 aa AA seqDB search
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYCQQKKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYVESVVYQILIEKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMDIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATVYDS
PKDQHLNGSVQGIQGQTEIENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQVEQGADLGLDSSTQEGFDYETNSLFDQQLGVYNKDLEYLGKCHSDLQDDSESYDLTQD
DNSSPCPGLDNEPHGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPK
SWHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITE
TDEQMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPE
QPVEITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFS
ALQLCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELK
MHVFKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHE
KCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISK
EDFVQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTK
TIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVR
TLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEV
KSNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGV
PAVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKY
RENFPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYI
FDNCHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQF
PQELNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPA
FKDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVF
AQLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCIL
MNNIQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEEC
IKQMSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLK
ELWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAI
MEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSR
SSKDAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDK
KRKQGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQ
NIAEKGSYGAWYPLLKSISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA
NT seq 6654 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaacaaagagtattgtcagcagaaaaag
gatcaagacttccccactgctggccagaccaaatcccccaaattttcttatacttttaaa
agcactgtaaagaagattgcaaagtgttcatccactcacaacttatccactgaggaagac
gaggccagtaaagagttttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatgctaaagtaaccaacagtgataatgaggatctgcttcaagagctc
tcttcaatcgagagttcctactcagaatcattaaatgaactaaggagtagcacagaaaac
caggcacaatcaacacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgacggggagcgtactctacatggcttaaaactgggagct
ttacgaaaactgagaaaatggaaaaagagtcaagaatgtgtctcctcagactcagagtta
agcaccatgaaaaaatcctggggaataagaagtaagtctttggacagaactgtccgaaac
ccaaagacaaatgccctggagccagggttcagttcctctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcacgtcaatgctctcaagcactccatcgatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagctgcgtacagggtttgtccagtctcgaagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaatgtgcctgaagaaagatttgagtatgttgaaagtgtggtgtaccaa
attctaatagagaaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagagactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcaacaaagggattctgtcttaaaaaagtcatataaactcaaaggaaca
ggcattggaatctcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatatgagagcatggatataaagttgtctactccagagccaaaa
atcaagaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctc
aatagaaacagttacgctgtgctttccaagtcagagcttctaacaaagggaagtacttcc
aagccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcaga
atttcaaataaatcagattatgataaaatctcctcacagttgccagaatcagatatcttg
gaaaagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttac
tcagaagatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtca
tcttcggaccgggagctatggcagaggaaacaggaaggaacagcgaccgtgtatgacagt
cccaaggaccagcatttgaatggaagtgttcagggtatccaagggcagactgaaattgaa
aacacagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccgg
agtcattacagtgattctcagctctctttacatgaggatctttctccatggaaggaatgg
aatcaagtagagcaaggagctgatttaggcttggattcatccacccaggaaggttttgat
tatgaaacaaatagtctttttgaccaacagcttggtgtttacaataaagacctagaatac
ttgggaaagtgccacagtgatcttcaagatgactcagagagctacgacttaactcaagat
gacaattcttctccatgccctggcttggataatgaaccacatggccagtgggttggccaa
tatgattcttatcagggagctaattctaatgagctataccaaaatcaaaaccagttgtcc
atgatgtatcgaagtcaaagtgaattgcaaagtgatgattcagaggatgccccacccaaa
tcatggcatagtcgattaagcattgacctttctgataagactttcagcttcccaaaattt
ggatctacactgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacag
agtctgagtgggtatgaggacagtggctcttcattaatggggagatttcggacattatct
caatcaactgcaaatgagtcaagtaccacacttgactctgatgtctacacggagccctat
tactataaagcagaggatgaggaagattatactgaaccagtggctgacaatgaaacagat
tatgttgaagtcatggaacaagtccttgctaaactagaaaacaggactagtattactgaa
acagatgaacaaatgcaagcatatgatcacctttcatatgaaacaccttatgaaacccca
caagatgagggttatgatggtccagcagatgatatggttagtgaagaggggttagaaccc
ttaaatgaaacatcagctgagatggaaataagagaagatgaaaaccaaaacattcctgaa
cagccagtggagatcacaaagccaaagagaattcgtccttctttcaaagaagcagcttta
agggcctataaaaagcaaatggcagagttggaagagaagatcttggctggagatagcagt
tctgtggatgaaaaggctcgaatagtaagtggcaatgacttggatgcttccaaattttct
gcactccagttgtgtggtggggctggaggtggactttatggtattgacagcatgccggat
cttcgcagaaaaaaaactttgcctattgtccgagatgtggccatgaccctggctgcccgg
aaatctggactctccctggctatggtgattaggacatccctaaataatgaggaactgaaa
atgcacgtcttcaagaagaccttgcaggcactgatctaccctatgtcttctaccatccca
cacaattttgaggtctggacggctaccacacccacctactgttatgagtgtgaagggctc
ctgtggggcattgcaaggcaaggcatgaagtgtctggagtgtggagtgaaatgccacgaa
aagtgtcaggacctgctaaacgctgactgcttgcagagagcagcagaaaagagttctaaa
catggtgccgaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatc
agggagaaaaaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaa
gaagattttgtgcagtttacaaaggcggccaaacagagtgtactggatgggacatctaag
tggtctgcaaaaataaccattacagtggtttctgcacagggtctacaggcaaaagataaa
acagggtctagtgatccatatgttacagttcaagttggaaagaacaaaagaagaacaaaa
accatttttggaaatttgaatccagtatgggatgagaagttttattttgagtgtcataac
tccacagatcgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtc
aagcaacatttcaaaaaggagtcagatgattttctgggacaaacaatcgtagaagtgagg
accttgagtggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagct
gtatctggggccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgct
ccatatcatattcaatatacatgtttacatgagaatctgttccattacttgactgaagtg
aaatctaatggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttc
tttgacgatgcttcccaagaaatagttgatgaatttgctatgcgttatggaattgaatcc
atttatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccccggtgtc
cctgccgtcatgagcaccttgctggctaatataaatgctttttatgctcacacaacagtt
tcaacaaatgtacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaa
aaattcataaaactactggaccagttacataactctttgaggattgatctgtcaaagtat
agggaaaactttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgac
ctgttaacaagtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaa
gcgagcatggtggtgaaggactgtgtaagggcttgcctggattctacatacaagtatatt
tttgacaattgccatgaactctactcccagctaacagacccgagtaagaaacaggatatt
cctcgtgaagatcagggaccaaccaccaagaatttggatttttggccccaacttattaca
ctgatggttactattattgatgaagataaaactgcctacacacctgtcctgaatcagttt
cctcaagagctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctg
gatatgaaatatgcattagaagaacatgaaaatcagcggttatgcaagagcaccgattat
atgaatttgcatttcaaagttaaatggttttataatgaatatgtgcgtgaacttcctgcc
ttcaaggatgctgttcctgaatactccttgtggtttgaaccttttgtcatgcagtggcta
gatgaaaacgaagatgtgtcaatggaattccttcatggagcactgggaagagacaaaaaa
gatggattccagcagacatctgatcatgctctcttttcttgctccgtggttgatgtcttt
gctcagctgaatcagagctttgaaattattaagaaactggaatgccctaatcctgaagca
ttatctcacttaatgagaagatttgcaaagactatcaataaagtgctgctccagtatgct
gcaattgtatcaagtgatttcagttcacattgtgataaggaaaatgtgccctgtatcttg
atgaacaatattcaacaactgcgggtccagctggaaaaaatgtttgaatccatgggaggg
aaggagctagattctgaagctagtactattctaaaagaacttcaggttaagctcagtggg
gtcctggatgagctcagcgtcacttatggtgaaagtttccaggttataattgaagagtgt
ataaaacagatgagtttcgaactaaaccaaatgagagcaaatggaaacaccacatctaat
aagaacagtgcagcaatggatgcagagattgtgttaagatctcttatggattttttggac
aaaacattaagtctctcagcaaaaatctgtgagaaaacagtcctcaagcgagttttaaaa
gagttatggaagctagttctcaacaaaatagaaaaacaaattgttcttcctcctctgaca
gatcaaacaggaccccagatgattttcattgcagctaaagatcttggacaattatccaaa
ctgaaggagcacatgattcgagaggatgccaggggtctgacgccaagacaatgcgctata
atggaggtagtcctggctaccatcaagcaatactttcatgcaggaggaaatggcctgaaa
aagaatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttat
acccaaactactgatgccttgataaagaaattcatagatactcaaacctcacagagtcgt
tcctccaaagatgccgtgggtcagatatctgttcatgtggacatcactgccaccccagga
acgggagatcataaagtcactgtaaaagtgattgctattaatgacctaaactggcagacc
acggcaatgttccgcccctttgtggaagtttgtatactgggacccaaccttggagacaag
aagagaaagcaaggcacaaaaacaaaaagcaacacatggtcaccaaagtacaatgaaaca
tttcagttcattctcggaaaggaaaatcgaccaggggcttatgaacttcatctctcagtt
aaggattactgctttgccagagaagatcgaattatcggaatgacagtcattcagctacag
aacatagcagaaaagggaagctatggggcatggtatcctcttctgaaaagtatctctatg
gatgaaactggtttgactatccttagaatactctctcagaggaccagtgatgatgtggct
aaagaatttgtaagacttaaatctgaaacaagatctactgaagagagtgcttga

DBGET integrated database retrieval system