KEGG   Pan paniscus (bonobo): 100993783Help
Entry
100993783         CDS       T02283                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 571 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGLQTQGKQDG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgaa
gagtttgaaggaggtggtggaggagaaggaaatgtgagccaggtgggaagagtttggcca
tcttcgtatcgagctcttataagtgccttttccagactgacacgtttggatgatttcacc
tgtgaaaaaatagggtctggcttcttttctgaagtgttcaaggtacgacaccgagcttct
ggtcaggtgatggctcttaagatgaacacgttgaacagtaaccgggcaaacatgctgaaa
gaagtacagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtatgt
gttcatcaaggacaactgcatgcacttacagagtatatcaactccgggaacctggaacag
ttgctagacagtaacctgcatttgccttggactgtgagggtaaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccccgatgtcagcatggggagtgagaagctggccgtggtgggttcccca
ttctggatggcacctgaggttctccgagatgagccctataatgaaaaggcagatgtgttc
tcttatggtatcatcctctgcgagatcatcgcccgcatccaggccgatccggactatctt
ccccgcacagagaatttcgggctggactatgatgctttccagcacatggtgggagactgt
cccccagattttctgcaacttactttcaactgctgtaacatggaccccaaactgcgccca
tcttttgtggagattgggaagaccctggaggaaattctgagccgcctacaggaagaagag
caggagagggataggaagctgcagcccacagccaggggactcttggagaaagcacctggg
gtgaagcgactaagctcactggatgacaagatcccccacaagtcaccatgcccaagacgt
accatctggctgtctcgaagccagtcagatatcttttcccgtaagcccccacgtacagtg
agtgtcttggacccatactacaggccacgagatggtgctgcccgcacccccaaagtcaac
ccttttagtgctcgccaggacctcatggggggcaagatcaagttttttgacctgcccagc
aagtctgtcatctctctggtatttgacctggatgcaccagggcccggaactatgcccctg
gctgactggcaggagcccctggccccacctattcgccggtggcgttccttgcctggttcg
cctgagttcttgcatcaagaggcttgtccatttgtgggccgggaagaatcgctatctgat
gggcccccaccacgcctaagtagtctcaagtacagagttaaagagatcccaccattccgg
gcatctgccctaccagctgctcaagcccatgaggctatggactgctccattctccaggaa
gaaaatggttttgggtccaggccccaggggaccagtccatgccctgcgggtgcttctgag
gagatggaggtagaagaaaggccagcaggctcaactccagccaccttctccacctcaggc
ataggcctgcaaacccagggaaagcaggatgggtga

DBGET integrated database retrieval system