KEGG   Pan paniscus (bonobo): 100993823Help
Entry
100993823         CDS       T02283                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pps03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 836 aa AA seqDB search
MIKTSPNQWLSATPAKNKIEATCTQCPSREHPQTRAPGGEDPPPPPRDPRCPARKAVASD
GLNHCESPNGGKQAVTAAREGLGARNERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDA
DEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIH
KIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTD
FDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVS
IEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYL
VTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSI
YETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRN
LFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAF
AWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGL
RSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQG
RLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVE
RRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEII
PLGIRSDLERCAPGVCSGGFKAPASTSFLFGVFCQNRRRWLRRLSDATGGTFSCAQ
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacatcccccaaccagtggttgtccgccactccggcaaagaacaagatagaa
gccacatgcacccaatgcccgtcccgtgagcaccctcagactcgagccccaggcggcgag
gacccgcccccgcccccacgtgacccgcgctgtcccgcgcggaaggcggtggcctcggat
ggactgaaccactgtgaaagcccgaatggggggaaacaggcagtgacggccgctagggaa
ggactgggggctcggaacgagcgctccgacagccgggcccaggcggtgtccgaggacgcg
ggaggaaacgagggcagagcggccgaggccgaaccccgggcgctggagaacggcgacgcg
gacgagccctccttcagcgaccccgaggacttcgtggacgacgtgagcgaggaagaatta
ctgggagatgtactcaaagatcggccccaggaagcagatggaatcgattcggtgattgta
gtggacaatgtccctcaggtgggacccgaccgacttgagaaactcaaaaatgtcatccac
aagatcttttccaagtttgggaaaatcacaaatgatttttatcctgaagaggatgggaag
acaaaagggtatattttcctggagtacgcgtcccctgcccacgctgtggatgccgtgaag
aacgccgacggctacaagcttgacaagcagcacacattccgggtcaacctcttcacggat
tttgacaagtatatgaccatcagtgatgagtgggatattccagagaaacagcctttcaaa
gacctggggaacttacgttactggcttgaagaggcagaatgcagagatcagtacagtgtg
atttttgagagtggagaccgcacttccatattctggaatgacgtaaaagaccctgtctca
attgaagagagagcgagatggacagagacgtatgtgcgttggtctcctaagggcacctac
ctggctacctttcatcaaagaggcattgctctatgggggggagagaaattcaagcaaatt
cagagattcagccaccaaggggtccagcttattgacttctcaccttgtgaaaggtacctg
gtgacctttagccccctgatggacacgcaggatgaccctcaggccataatcatctgggac
atccttacggggcacaagaagaggggttttcactgtgagagctcagcccattggcctatt
tttaagtggagccatgatggcaaattctttgccagaatgaccctggatacgcttagcatc
tatgaaactccttctatgggtcttttggacaagaagagtttgaagatctctgggataaaa
gacttttcttggtctcctggtggtaacataatcgccttctgggtgcctgaagacaaagat
attccagccagggtaaccctgatgcagctccctaccaggcaagagatccgagtgaggaac
ctgttcaatgtggtggactgcaagctccattggcagaagaacggagactacttgtgtgtg
aaagtagataggactccgaaaggcacccagggtgttgtcacaaattttgaaattttccga
atgagggagaaacaggtacctgtggatgtggtcgagatgaaagaaaccatcatagccttt
gcctgggaaccaaatggaagtaagtttgctgtgctgcacggagaggctccgcggatatct
gtgtctttctaccacgtcaaaaacaacgggaagattgaactcatcaagatgttcgacaag
cagcaggcgaacaccatcttctggagcccccaaggacagttcgtggtgttggcgggcctg
aggagtatgaacggtgccttagcgtttgtggacacttcggactgcacggtcatgaacatc
gcagagcactacatggcttccgacgtcgaatgggatcctactgggcgctacgtcgtcacc
tctgtgtcctggtggagccataaggtggacaacgcgtactggctgtggactttccaggga
cgcctcctgcagaagaacaacaaggaccgcttctgccagctgctgtggcggccccggcct
cccacactcctgagccaggaacagatcaagcaaattaaaaaggatctgaagaaatactct
aagatctttgaacagaaggatcgtttgagtcagtccaaagcctcaaaggaattggtggag
agaaggcgcaccatgatggaagatttccggaagtaccgaaaaatggcccaggagctctat
atggagcagaaaaacgagcgcctggagttgcgaggaggggtggacactgacgagctggac
agcaacgtggacgactgggaagaggagaccattgagttcttcgtcactgaagaaatcatc
cccctcggaatcaggagtgacctggagcgctgtgcccctggtgtctgcagtgggggattt
aaggcacccgcttccacttctttcttgtttggagttttctgtcagaaccgccggcgttgg
ctccgtagacttagcgacgctactggcggcaccttctcctgcgcccagtga

DBGET integrated database retrieval system