KEGG   Pan paniscus (bonobo): 100993823Help
Entry
100993823         CDS       T02283                                 

Gene name
EIF3B
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
pps  Pan paniscus (bonobo)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100993823 (EIF3B)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100993823 (EIF3B)
Translation factors [BR:pps03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100993823 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 726 aa AA seqDB search
MIFGRGLVDASPLRVVARNERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSD
PEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFG
KITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTI
SDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARW
TETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLM
DTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMG
LLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDC
KLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGS
KFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGAL
AFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNN
KDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMME
DFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGIRSD
LERCGD
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgattttcggacgcggtcttgtggatgcgagtcctctcagggtcgtcgctcggaacgag
cgctccgacagccgggcccaggcggtgtccgaggacgcgggaggaaacgagggcagagcg
gccgaggccgaaccccgggcgctggagaacggcgacgcggacgagccctccttcagcgac
cccgaggacttcgtggacgacgtgagcgaggaagaattactgggagatgtactcaaagat
cggccccaggaagcagatggaatcgattcggtgattgtagtggacaatgtccctcaggtg
ggacccgaccgacttgagaaactcaaaaatgtcatccacaagatcttttccaagtttggg
aaaatcacaaatgatttttatcctgaagaggatgggaagacaaaagggtatattttcctg
gagtacgcgtcccctgcccacgctgtggatgccgtgaagaacgccgacggctacaagctt
gacaagcagcacacattccgggtcaacctcttcacggattttgacaagtatatgaccatc
agtgatgagtgggatattccagagaaacagcctttcaaagacctggggaacttacgttac
tggcttgaagaggcagaatgcagagatcagtacagtgtgatttttgagagtggagaccgc
acttccatattctggaatgacgtaaaagaccctgtctcaattgaagagagagcgagatgg
acagagacgtatgtgcgttggtctcctaagggcacctacctggctacctttcatcaaaga
ggcattgctctatgggggggagagaaattcaagcaaattcagagattcagccaccaaggg
gtccagcttattgacttctcaccttgtgaaaggtacctggtgacctttagccccctgatg
gacacgcaggatgaccctcaggccataatcatctgggacatccttacggggcacaagaag
aggggttttcactgtgagagctcagcccattggcctatttttaagtggagccatgatggc
aaattctttgccagaatgaccctggatacgcttagcatctatgaaactccttctatgggt
cttttggacaagaagagtttgaagatctctgggataaaagacttttcttggtctcctggt
ggtaacataatcgccttctgggtgcctgaagacaaagatattccagccagggtaaccctg
atgcagctccctaccaggcaagagatccgagtgaggaacctgttcaatgtggtggactgc
aagctccattggcagaagaacggagactacttgtgtgtgaaagtagataggactccgaaa
ggcacccagggtgttgtcacaaattttgaaattttccgaatgagggagaaacaggtacct
gtggatgtggtcgagatgaaagaaaccatcatagcctttgcctgggaaccaaatggaagt
aagtttgctgtgctgcacggagaggctccgcggatatctgtgtctttctaccacgtcaaa
aacaacgggaagattgaactcatcaagatgttcgacaagcagcaggcgaacaccatcttc
tggagcccccaaggacagttcgtggtgttggcgggcctgaggagtatgaacggtgcctta
gcgtttgtggacacttcggactgcacggtcatgaacatcgcagagcactacatggcttcc
gacgtcgaatgggatcctactgggcgctacgtcgtcacctctgtgtcctggtggagccat
aaggtggacaacgcgtactggctgtggactttccagggacgcctcctgcagaagaacaac
aaggaccgcttctgccagctgctgtggcggccccggcctcccacactcctgagccaggaa
cagatcaagcaaattaaaaaggatctgaagaaatactctaagatctttgaacagaaggat
cgtttgagtcagtccaaagcctcaaaggaattggtggagagaaggcgcaccatgatggaa
gatttccggaagtaccgaaaaatggcccaggagctctatatggagcagaaaaacgagcgc
ctggagttgcgaggaggggtggacactgacgagctggacagcaacgtggacgactgggaa
gaggagaccattgagttcttcgtcactgaagaaatcatccccctcggaatcaggagtgac
ctggagcgctgtggggactga

DBGET integrated database retrieval system