KEGG   Pan paniscus (bonobo): 100993844Help
Entry
100993844         CDS       T02283                                 

Gene name
PRKX
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100993844 (PRKX)
Protein kinases [BR:pps01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100993844 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 358 aa AA seqDB search
MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPAYSLQDFDTLATVGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDER
FLYMLMEYVPGGELFSYLRNRGRFSSTSGLFYSAEIICAIEYLHSKEIVYRDLKPENILL
DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKRH
RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgggctggcccaggcggccgcggcggagagcgactcccgcaaggtggcg
gaggagacccccgacggggcgcccgcgctctgccccagccctgaggcgctgtcgccggag
ccgcctgcgtacagcctgcaggactttgacacgctggccaccgtgggcactgggacgttt
gggcgggtgcacctggtgaaggagaagacagccaagcatttcttcgccctcaaggtgatg
agcattcccgacgtcatccgcctgaagcaggagcagcacgtgcacaatgagaagtctgtc
ctgaaggaagtcagccacccgttcctcatcaggctgttctggacgtggcatgacgagcgc
ttcctctacatgctcatggagtacgtgccgggtggcgagctcttcagctacctgcgcaac
cgggggcgcttctccagcacctcggggctcttctactctgcggagatcatctgtgccatc
gagtacctgcactccaaggagatcgtctacagggatttgaagccggagaacatcctgctg
gatagggatggccacatcaagctcacggactttgggttcgccaagaagctggtagacagg
acttggaccctctgtggaacacctgagtacctagcccccgaagtcattcagagcaagggc
cacggaagggctgtggactggtgggccctcggcatcctgatattcgagatgctttcgggg
tttcctccgttttttgatgacaacccgtttggcatttatcagaaaattcttgcaggcaaa
atagatttccccagacatttggatttccacgtaaaagacctcattaagaaactgctcgtg
gttgacagaacaaggcgattaggaaacatgaagaacggggcgaatgatgtgaaacgtcat
cggtggttccgctccgtggactgggaagctgttccgcagagaaaactgaagcctcccatc
gtgcccaagatagctggcgacggcgacacttccaacttcgaaacttaccctgagaatgac
tgggacacagccgcgcccgtgccgcagaaggatttagaaatcttcaagaatttctga

DBGET integrated database retrieval system