KEGG   Pan paniscus (bonobo): 100993959Help
Entry
100993959         CDS       T02283                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04071  Sphingolipid signaling pathway
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04650  Natural killer cell mediated cytotoxicity
pps04662  B cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04810  Regulation of actin cytoskeleton
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
pps05416  Viral myocarditis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100993959 (RAC2)
   04015 Rap1 signaling pathway
    100993959 (RAC2)
   04010 MAPK signaling pathway
    100993959 (RAC2)
   04310 Wnt signaling pathway
    100993959 (RAC2)
   04370 VEGF signaling pathway
    100993959 (RAC2)
   04071 Sphingolipid signaling pathway
    100993959 (RAC2)
   04024 cAMP signaling pathway
    100993959 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100993959 (RAC2)
   04520 Adherens junction
    100993959 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100993959 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100993959 (RAC2)
   04662 B cell receptor signaling pathway
    100993959 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100993959 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100993959 (RAC2)
   04670 Leukocyte transendothelial migration
    100993959 (RAC2)
   04062 Chemokine signaling pathway
    100993959 (RAC2)
  Development
   04360 Axon guidance
    100993959 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100993959 (RAC2)
   05231 Choline metabolism in cancer
    100993959 (RAC2)
   05210 Colorectal cancer
    100993959 (RAC2)
   05212 Pancreatic cancer
    100993959 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100993959 (RAC2)
   05416 Viral myocarditis
    100993959 (RAC2)
GTP-binding proteins [BR:pps04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100993959 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 100993959
NCBI-ProteinID: XP_003821605
Position
22
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRTCSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctatccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccagaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gatgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctagagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcacctgcagcctcctctag

DBGET integrated database retrieval system