KEGG   Pan paniscus (bonobo): 100993999Help
Entry
100993999         CDS       T02283                                 

Definition
arachidonate 12-lipoxygenase, epidermal-type-like
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
pps  Pan paniscus (bonobo)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100993999
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100993999
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100993999
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100993999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 662 aa AA seqDB search
MGKYTVRVATGDLLLAGSPNLVQLWLVGEHGEADLGKXLPPVWGKEAEFEIDVNVHLGRL
LMVKLRKHNVLLSLDWFCKWISVQGPGTQGEAFFPCYRWVQGHGIICLPEGTARTVSDDP
QNLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRDGRFLEDKDLDFNVSLAK
GLKDLAIQGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPML
LRRSSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQYVAAPL
VMLKLQPVGGLLPMVIQLQPPXHGCPPPLLFLPSHPPMAWLLGKTWVRSSDFQLQQLQSH
LLRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLAQSSLVSEWGIFDLVVGT
GSGGHVDILQRAMACLTYHSLCPPDDLADRGLLDVKSSFYGXDAIRLWGIISRYVEGMVG
LFYKSDQAMKDDLELQAWCREMTETGLQRAQDQGFLISLESRAQLCHFVTMCIFTCTGQH
ASNHLGQLDWCSWIPNGPCTMQKPPPISKDVTEKDIVDLLPNLHQARMQKTFTKFLGRRQ
PVMVALGQREETYFSGPEPQAVLRQFQEELAAMDKEIEVRNAVLDLPCEYLXPSMVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtagccaccggggatttgctcctggcgggctctcccaac
ctggtgcagctgtggctggtgggcgagcacggggaggcagacctagggaagtagctgcca
ccggtgtggggaaaggaggcagagtttgagatcgacgtcaacgtgcacctggggcgcctc
ctgatggtgaagctgcgcaaacacaacgtgctgttgagtctcgactggttctgcaagtgg
atctcagtgcagggcccggggacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggccacggaattatctgcctgcctgagggtactgcccggaccgtgagtgatgacccc
cagaacctgtttaagaaatatcgggaacaggagctcgaggaaagaaggaaggtgtaccgg
tggggctcctggaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctagggacgggcgattcctcgaggataaggatttagactttaatgtctccctagcaaaa
gggttgaaggacttggccattcaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcaatggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccggcctgcctggtgctgcctccagggatggaagacttg
aagacccagctggaaaaagaactccaggctggatctctgtttgaagtggacttctccttg
ctggatggagtcaagcctaatgtcatcatttttaagcagcaatacgtggcagcccctttg
gtcatgctgaagcttcagcctgttggaggactcttacccatggtcatccagctccagcca
ccttgacacggatgtcccccacctctgctctttctgccctcgcatccccccatggcctgg
ctcctgggcaagacctgggtccggagctctgatttccagctgcagcagttacagtcacat
ctgctgaggggacacttgattgctgaggttattgctgtggctacaatgagaagcttgcct
agcctccatcctatctacaagctcctgatcccccacttccgctacaccatggcgatcaac
acgctggcccagagtagtcttgtctccgaatggggaatttttgacctcgtggtgggcact
ggtagtggaggccacgtggacattcttcagagagccatggcttgtttgacctatcattcc
ctctgtcctcctgatgacctggctgaccgtgggctcctggatgtgaaatcttctttttat
ggctaagatgccatcaggctgtggggaatcatcagccggtacgtggaggggatggttggg
cttttctacaagagtgaccaagccatgaaggatgatctagagctgcaggcctggtgcaga
gagatgactgagactggactgcagagggcccaagaccaggggttcctcatctccttagag
tcccgggctcagctctgccactttgtcaccatgtgcatcttcacatgcacaggtcagcat
gcttctaaccacctgggccagctggactggtgctcctggatccctaatggcccatgcact
atgcagaagcccccgcccatctctaaggatgtgacagagaaggatatagtggacttactg
cccaatctccaccaggcacgtatgcaaaagaccttcacaaagttccttggcagacgccag
cctgtcatggtggccctggggcagcgtgaggagacatatttctctggtcctgagccccaa
gctgtgctgagacaattccaggaggaactggctgccatggacaaggagattgaggtccgg
aatgcagtcctggacctgccctgtgagtacctttgacccagcatggtagagaacagcgtg
accatctga

DBGET integrated database retrieval system