KEGG   Pan paniscus (bonobo): 100994023Help
Entry
100994023         CDS       T02283                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100994023 (USP24)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100994023 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2445 aa AA seqDB search
MDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPIGLLGVLTMA
FNPDNEYHFKNRMKVSQRNWAEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFA
AIQAKLHSEDIELGAVSALIQPLGVCAEYLNSSVVQPMLDPVILTTIQDVRSVEEKDLKD
KRLVSIPELLSAVKLLCMRFQPDLVTIVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIE
DSTLSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDEL
TKIWKIQSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWETESDRVRQKLLSLI
GRIGREARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAIKRSYI
IKCIEDIKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQD
KSIIQDLKKNFEIVKLVTGSLIACHRLAAAVAGPGGLSGSTLVDGRYTYREYLEAHLKFL
AFFLQEATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEK
ILKLESYEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELIGMDFIWKIAMESPD
EEIANEAIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTR
ATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASF
HGHLLTLNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDNIQIFTNDSLLTVNKD
QKLLHQLGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSSSGVFSSSYAMEQEKSLPGVV
MALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESS
SQSSKSPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMAR
SCAKSFCENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTL
LDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAA
RVAIQTMEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLCPAGIRNRLSSSGS
NCSSGSEGEPVALHAGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVA
DFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQLPLWSPTS
IMRGVNQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATMLEDEITWLDNFEPNRTAE
CETSEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIILNSHSPAG
SAAISQQDFHPKCSTANSRLAAYEVLVMLADSSPSNLQIIIKELLSMHHQPDPALTKEFD
YLPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQV
QSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGRD
QIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSN
AYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPY
TVSGMARQDSSSEVGENGRSVDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFI
KDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAY
MLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSIL
TKLVKKGEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKH
PYYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQWLVEYFIS
SEGRELIKIFLLECNVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVP
ENCKNCAQYFFLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGASRQNNQIRRWSSAQAR
EFGNLHNTVALLVLHSDVSSQRNVAPGVFKQRPPISIAPSSPLLPLHEEVEALLFMSEGK
PYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQL
LHEILVIEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKE
YFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNE
KEQSGSSNGSESSPANENGDRHLQQGSESPMMIGELRSDLDDVDP
NT seq 7338 nt NT seq  +upstreamnt  +downstreamnt
atggataggtgtatgcctgaagcatttaaaaagctcctgacatcaagtgctgtccacaag
tggggtactgaaattcatgaaggaatttacaacatgttgatgctattaatagaactggtc
gcagagagaataaaacaagatccaattcccattggtctcctgggtgtgcttacaatggct
ttcaatcctgataatgaataccattttaaaaacagaatgaaagtgtctcaaaggaattgg
gcagaagtgtttggagagggaaatatgtttgctgtttcacctgtatcgactttccaaaag
gaacctcatggatgggttgtggatttggtaaataagttcggagaattaggtggatttgca
gcaatccaagccaagctccattcagaagatatagaacttggggctgtctcagcactgatt
cagcccttaggagtgtgtgcagagtacctcaattcctccgtggtacagcccatgctagac
ccagtcattcttactacaatccaggatgtacggagtgtagaagagaaagacctcaaagac
aagagattagttagcatccctgagctcttgtctgccgttaagttactttgcatgcgcttc
caaccggatctggtgacaattgtggatgaccttcgactagatattctattgcgcatgctg
aaatcaccacatttcagtgctaagatgaattctctcaaagaagtaaccaaactaatagaa
gatagcactttatccaaatctgtgaagaatgctatagatacagacagattattagattgg
ctagttgaaaactcagttctgtcgattgcactggaaggcaacatagaccaagcacaatac
tgtgaccgtataaagggaattattgaactcttgggtagtaaattgtcgttagatgaactc
actaaaatttggaagatacagtcaggacaatcatctactgtgattgagaacattcatact
attattgctgcagcggctgtgaaatttaattcagatcagcttaatcatttgtttgttctc
attcagaagagctgggagactgagagtgatagagtaagacagaagcttttgagcctgatt
ggacgaataggccgggaagctcgctttgagaccacttctggaaaggttttagacgtactc
tgggaactggctcaccttccaaccctgcccagtagccttattcagcaggccttggaggag
cacctgacaatccttagtgatgcatatgcagtgaaagaagcgatcaagaggagctacatc
atcaagtgcatagaagatattaagaggcctggagaatggtcaggtttggaaaaaaacaag
aaggatggattcaagtcatctcagcttaataatccccagtttgtatgggtggtaccagct
ttgcgtcagctccatgaaattactcgctcattcataaaacaaacctatcaaaagcaagac
aagagcattattcaagacttgaagaagaattttgaaatagtgaaattggtaacgggaagt
ttgatcgcttgtcatcggcttgcagctgctgtggccgggcctggaggcttaagtggctca
acactagtggatggccggtacacttaccgggagtatttagaggcacatctaaaatttcta
gcatttttcttgcaagaagctactctgtatctgggctggaatcgtgccaaggagatctgg
gagtgtcttgtaactggccaggatgtttgtgaattagatagagagatgtgttttgaatgg
tttacaaaaggacagcatgatcttgagagtgatgttcagcagcagctcttcaaggagaaa
attcttaaattggagtcatatgaaatcactatgaatggttttaacttatttaaaactttt
tttgaaaatgtgaatctttgtgatcatcgattgaaaagacaaggagctcagttgtatgta
gaaaagctggaattgataggaatggatttcatttggaaaatagccatggaatcacctgat
gaagaaattgctaatgaagctattcagctaatcataaactatagttacattaatctaaat
cctagattaaagaaggattcagtatctttacataagaaattcattgctgattgctacaca
agattagaagcagccagttcagcacttggtggccccactctaacacatgctgtgaccaga
gcaacaaaaatgcttacagcaactgccatgccaactgtagcaacctcagttcagtctcct
tatagatccactaaacttgtaataattgagagattgctgcttctggcagagcgctatgtg
atcactatagaggatttttactctgttccacgaactattctacctcatggtgcctcattt
catggacatcttttaactcttaatgttacctatgagtctaccaaagataccttcactgtc
gaggctcacagtaatgaaaccatagggagtgtccggtggaaaatagccaagcagttgtgc
tctcctgtggataatatacagatatttacaaatgatagcctgctgacagtgaataaagat
caaaagctactccaccaactgggcttttctgatgaacaaatccttacagtgaagacttct
ggcagtgggaccccatctgggagttcagcagattcttcaaccagctccagcagcagcagc
agtggggtttttagttcttcatatgccatggagcaggagaaatccctccctggtgtagtg
atggctctcgtatgtaatgtatttgacatgctttatcagctcgccaatctggaagagcca
aggataactctacgagtacggaagcttctgctcttgatacccactgatccagccattcag
gaagcccttgatcaacttgattctttaggaagaaagaaaacattgctgtctgaatcaagt
tctcagtcctcaaaatctccatccctgtcatcaaagcaacagcaccagccaagtgccagt
tcaattttagaaagtctgtttcgatcttttgccccgggaatgtctaccttcagagtgctc
tacaacttagaagttctaagctccaaactcatgccaacagctgatgatgacatggccaga
agctgtgccaaatccttctgtgaaaacttcctcaaagctggcggtttgagtttggttgta
aatgtcatgcagagagactccatcccatcagaagtagactatgaaacaaggcagggtgtt
tattccatctgtctacagcttgcaagatttttacttgtcggacaaacaatgcccacgtta
ttagatgaagacctcaccaaagatggcatagaagcactttcttcccgcccattccgaaat
gtcagccggcagacaagcagacagatgtccttatgtggtaccccagaaaagtcatcctac
cgacagttgtccgtgtctgataggtcttctattagggttgaggaaatcatccctgctgct
cgagttgcaatacaaacaatggaagtaagtgatttcacttctactgtggcttgcttcatg
agattgtcatgggctgcggctgcaggacggcttgatcttgttgggagtagccagccaatt
aaagaaagtaattccctgtgtcctgctggaattcgaaacagactcagcagttcaggaagc
aattgcagctctggaagtgaaggagaaccagtagccctgcatgcaggaatctgtgttcga
caacagtctgtatccaccaaagactctctgattgcgggagaggctttgtctcttctcgtt
acgtgcctacagcttcggagccagcaactggcatctttctataacttgccctgtgttgct
gatttcatcattgatattctgctcggatcaccaagtgctgagattcgccgggttgcctgt
gatcagctgtacactcttagtcagacagacacatcagcgcatccagatgtgcagaagcca
aatcagtttcttctaggcgtaatcctcacggctcagctgcctctctggtctccaactagt
attatgagaggagtcaatcagagactgttatctcagtgtatggagtattttgatttgaga
tgccagttattagatgatctgacaacttcagaaatggagcagttaaggatcagcccagct
acgatgcttgaagatgagattacttggctggataactttgaacctaatcgtacagctgaa
tgtgagaccagtgaagcggacaacatcttactggcagggcacttacgcctcatcaagacc
cttctttcactctgtggggcagaaaaggaaatgcttggttcatcactcattaaaccattg
ttagatgacttccttttccgagcttctagaattattttaaatagtcattctccagctggc
agtgccgccatcagtcaacaggactttcatccaaagtgtagtacagcgaatagccgattg
gcagcctatgaagtccttgtgatgttggctgatagttcaccttcaaatcttcaaattatt
ataaaagaactgctttctatgcatcaccaacctgaccctgctcttaccaaggagtttgat
taccttcccccagtggatagcaggtccagttcagggtttgtggggctgagaaatggtggt
gcaacttgttatatgaatgcagtcttccagcagctgtatatgcaacctgggctccctgag
tcattactttcagtggatgatgacacagacaatccagatgatagtgtgttttaccaagtg
cagtctctctttgggcatttaatggaaagcaagctgcagtactatgtacctgagaatttt
tggaagattttcaagatgtggaataaagaactttatgtgagagaacagcaggatgcatat
gaattctttactagtctcattgatcagatggatgaatacctcaagaaaatggggagagac
caaatttttaagaatacatttcagggcatctactctgatcagaagatctgtaaagactgt
cctcacagatatgagcgtgaagaagctttcatggctctcaatctaggagtgacttcttgt
cagagtttggaaatttctttggaccaatttgttagaggagaagttctagaaggaagtaat
gcgtactactgtgaaaagtgtaaagaaaagagaataacagtgaaaaggacctgtattaaa
tctttacctagcgtcttggtaattcacctaatgagatttgggtttgactgggaaagcgga
cgctccattaaatatgatgaacaaataaggtttccctggatgctaaacatggagccttac
acagtttcaggaatggctcgccaagattcttcttctgaagttggggaaaatgggcgaagt
gtggatcagggaggtggaggatccccacgaaaaaaggttgccctcacagaaaactatgaa
cttgtcggtgtcatcgtacacagtgggcaggcacacgcaggccactactattccttcatt
aaggacaggcgagggtgtggaaaaggaaagtggtataaatttaatgacacagttatagaa
gaatttgacctaaatgatgagaccctggagtatgaatgctttggaggagaatatagacca
aaagtttatgatcaaacaaacccatacactgatgtgcgccgaagatactggaatgcctat
atgcttttctaccaaagggtgtctgatcagaactccccagtattaccaaagaaaagtcga
gtcagtgttgtacggcaggaagctgaggatctctctctgtcagctccatcttcaccagaa
atttcacctcagtcatcccctcggccccataggccgaacaatgaccggctgtctattctt
accaagctggttaaaaaaggcgagaagaaaggactgtttgtggagaaaatgcctgctcga
atataccagatggtgagagatgagaacctcaagtttatgaagaatagagatgtgtacagt
agtgattatttcagttttgttttgtctttagcttcgttgaatgctactaaattaaagcat
ccatattatccttgcatggcaaaggtgagcttacagcttgctattcaattcctttttcaa
acttatctacggacaaagaagaaactcagggttgatactgaagaatggattgctaccatt
gaagcattgctctcaaaaagttttgatgcttgtcagtggttagttgaatattttattagt
tctgaaggacgagaattgataaagattttcttactggagtgcaatgtgagagaagtacga
gttgctgtggccaccattctggagaaaaccctagacagtgccttgttttatcaggataag
ttaaaaagccttcatcagttactggaggtactacttgctctgttggacaaagacgtccca
gaaaattgtaaaaactgtgctcagtactttttcctgttcaacacttttgtacaaaagcaa
ggaattagggctggagatcttcttctgaggcattcagctctgcggcacatgatcagcttc
ctcctaggggccagtcggcaaaacaatcagatacgtcgatggagttcagcacaagcacga
gaatttgggaatcttcacaatacagtggcgttacttgttttgcattcagatgtctcatcc
caaaggaatgttgctcctggcgtatttaagcaacgaccacccattagcattgctccctca
agccctctgctgcccctccatgaggaggtagaagccttgttgttcatgtctgaagggaaa
ccttacctgttagaggtaatgtttgctttgcgggagctgacaggctcgctcttggcactc
attgagatggtagtgtactgctgtttctgtaatgagcatttttccttcacaatgctgcat
ttcattaagaaccaactagaaacggctccacctcatgagttaaagaatacgttccaacta
cttcatgaaatattggttattgaagatcccatacaagtagagcgagtcaaatttgtgttt
gagacagaaaatggattactagctttgatgcaccacagtaatcatgtggacagtagtcgc
tgctaccagtgtgtcaaatttcttgtcactcttgctcaaaagtgtcctgcagctaaggag
tacttcaaggagaattcccaccactggagctgggctgtgcagtggctacagaagaagatg
tcagaacattactggacaccacagagtaatgtctctaatgaaacatcaactggaaaaacc
tttcagcgaaccatttcagctcaggacacgttagcgtatgccacagctttgttgaatgaa
aaagagcaatcaggaagcagtaatgggtcggagagtagtcctgccaatgagaacggagac
aggcatctacagcagggttcagaatctcccatgatgattggtgagttgagaagtgacctt
gatgatgttgatccctag

DBGET integrated database retrieval system