KEGG   Pan paniscus (bonobo): 100994078Help
Entry
100994078         CDS       T02283                                 

Gene name
CES2
Definition
carboxylesterase 2
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
pps  Pan paniscus (bonobo)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100994078 (CES2)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100994078 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100994078 (CES2)
    3.1.1.84  cocaine esterase
     100994078 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 729 aa AA seqDB search
MTAQSRSPTTPTFPGPSQRTPPTPCPVQTPRLGKALIHGWTDPGQPLGEQQRVRRQRTET
SEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQ
TFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTPVKSEFLSQFNVTYPS
VSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQ
YRLGVLGFFSTGDKHATGNWGYLDQVAALRWVRQNIAHFGGNPDRVTIFGESAGGTSVSS
LVVSPISQGLFHGAIMESGVALXXXXXXXSSPCLVPLQVVANLSSCDQVDSEALVGCLRG
KSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNDEFGWVIPKVM
RIYDTQKEMDREASQAALQKMLTLMMLPPTFGDLLMEEYIGDNGDPQTLQAQFQEMMADY
MFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKY
WANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWXXXXXPTTKPYE
VWDEDQDTYIAHIGHQFIAPSYRSPSALIGPVDEDRFEERIPWIADWLRKPRGPFRGCQR
GPDPPFPGPSQRTPPTPCPVQTPRPGEALIHGWTDPGQPLGEQQRVHWQRTETSEPTMRL
HRLRTRLSA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagtcccgctctcctaccacacccacctttcccggcccaagccagcgcacc
ccgccgactccctgcccagtccaaactccaaggctgggcaaggcactgatccacggctgg
accgacccggggcagcctctgggtgaacagcagcgtgtccgccggcagcgaaccgagacc
agcgagccgaccatgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtggg
cttctgctgcttcttgtccggggccagggccaggactctgccagtcccatccggaccaca
cacacagggcaggtgctggggagtcttgtccacgtgaagggcgccaatgccggggtccaa
accttcctgggaattccatttgccaagccacctctaggtccgctgcgatttgcaccccct
gagccccctgaatcttggagtggtgtgagggatggaaccacccatccagccatgtgtcta
caggacctcaccccagtgaagtcagagtttcttagccagttcaacgtgacctacccttcc
gtctccatgtccgaggactgcctgtacctcagcatctacacgccggcccatagccatgaa
ggctctaacctgccggtgatggtgtggatccatggtggtgcgcttgtttttggcatggct
tccttgtatgatggttccatgctggccgccttggagaacgtggtggtggtcatcatccag
taccgcttgggtgtcctgggcttcttcagcactggagacaagcacgcaaccggcaactgg
ggctacctggaccaagtggctgcactacgctgggtccggcagaatatcgcccactttgga
ggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcg
cttgttgtgtcccccatatcccaaggactcttccacggagccatcatggagagtggcgtg
gccctccnnnnnnnnnnnnnnnnnnnntctagcccctgcctggtccctttgcaggtggtg
gccaacctgtcttcctgtgaccaagttgactctgaggccctggtgggctgcctgcggggc
aagagtaaagaggagattcttgcaattaacaagcctttcaagatgatccccggagtggtg
gatggggtcttcctgcccaggcacccccaggagctgctggcctctgccgactttcaacct
gtccccagcatcgttggtgtcaacaacgatgagtttggctgggtcatccccaaggtcatg
aggatctatgatacccagaaggaaatggacagagaggcctcccaggctgctctgcagaaa
atgttaacgctgatgatgttgcctcctacatttggtgacctgctgatggaggagtacatt
ggggacaatggggatccccagaccctccaagcccagttccaagagatgatggcagactac
atgtttgtgatccctgcactccaagtagcacattttcagtgttcccgggcccctgtgtac
ttctacgagttccagcatcagcccagctggctcaagaacatcaggccaccgcacatgaaa
gcagaccatgttaaattcactgaggaagaggagcagctaagcaggaagatgatgaagtac
tgggccaactttgcgcgaaatgggaaccccaatggcgagggtctgccacactggccgctg
ttcgaccaggaggaacaatacctgcagctgaacctacagcctgcggtgggccgggctctg
aaggcccacaggctccagttctggaannnnnnnnnnnncccaaccacgaagccctatgaa
gtttgggacgaagaccaggacacctacattgcccatattggccaccagtttattgccccc
tcctatcgatcccccagcgcgctcatcgggcctgtggacgaggacaggtttgaggagagg
attccctggatcgcggattggctacggaagccgcgcggccccttccgcggatgccaaagg
ggaccggacccacctttccccggcccaagccagcgcaccccgcccactccctgcccagtc
caaactccgaggccgggcgaggcactgatccacggctggaccgacccggggcagcctctg
ggtgaacagcagcgtgtccactggcagagaaccgagaccagcgagccgaccatgcggctg
caccgacttcgcacgcggctgagcgcg

DBGET integrated database retrieval system