KEGG   Pan paniscus (bonobo): 100994084Help
Entry
100994084         CDS       T02283                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pps  Pan paniscus (bonobo)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100994084 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100994084 (MGST3)
   00982 Drug metabolism - cytochrome P450
    100994084 (MGST3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100994084 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100994084 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    100994084 (MGST3)
Enzymes [BR:pps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100994084 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 151 aa AA seqDB search
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFXAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLVGTTVCSAFQHLGWVKSGLGSGPKCH
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggttttgtgcttctaactggtgctgccagctttata
atggtggcccacctagccatcaatgtttccaaggcccgcaagaagtacaaagtggagtat
cctatcatgtacagcacggaccctgaaaatgggcacatcttcaactgcattcagcgagcc
caccagaacacgttggaagtgtatcctcccttcttatttttcntagctgttggaggtgtt
taccacccgcgtatagcttctggcctgggcttggcctggattgttggacgagttctttat
gcttatggctactacacaggagaacccagcaagcgtagtcgaggagccctggggtccatc
gccctcctgggcttggtgggcacaactgtgtgctctgctttccagcatcttggttgggtt
aaaagtggcttgggcagtggacccaaatgccattaa

DBGET integrated database retrieval system