KEGG   Pan paniscus (bonobo): 100994153Help
Entry
100994153         CDS       T02283                                 

Gene name
USP43
Definition
ubiquitin specific peptidase 43
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100994153 (USP43)
Peptidases [BR:pps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100994153 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1115 aa AA seqDB search
MDLVSLCINHPTGLLEEQEQRRNPGLSVYEVRKGGESDHEDSQSAPRGRHQAEVGVARRC
PGGGWSCRGIPARGGAAPPLAPPPPRPRTPGPQGLKNHGNTCFMNAVVQCLSNTDLLAEF
LALGRYQAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQGNSQHDALE
FLLWLLDRVHEDLEGSSRGPVSEKLPPEATKTSENCLSPSAQLPLGQSFVQSHFQAQYRS
SLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAVPILSTVAA
LRKMVAEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPPSPSQGTLS
AHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVS
WAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKDSRPLCHWAVDRVL
HLRRPGGPPHVKLAVEWDSSVKERLFGSLQEERAQDADSVWQQQQAHQQHSCTLDECFQF
YTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRFCQVGERRNKLSTLVKF
PLSGLNMAPHVAQRSTSPEAGLGPWPSWKQPDCLPTSYPLDFLYDLYAVCNHHGNLQGGH
YTAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRNSIPPWSASSSMRGSTSS
SLSDHWLLRLGSHAGSTRGSLLSWSSAPCPSLPQVPDSPIFTNSLCNQEKGGLESRRLVR
GVKGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKPPGASVELVEYLESRRRPRSTSQS
IVSLLTGTAGEDEKSASPRSNVALLANSEDGGQAIERGPAGVPCPSAQPNHCLAPGNSDG
PNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPP
SPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQVPPVSLVSG
GLSPAMVGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAPRGSALGMS
QRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgtgtccttgtgtattaatcacccaaccgggctgctcgaggaacaggagcag
cggcgaaacccaggtctgtcggtttacgaggtaaggaagggtggggaatccgaccacgaa
gactcccagtcagcgccgcgggggcggcaccaggcagaggtaggggtggcccggcgctgc
cctggagggggctggtcgtgccgcgggattcccgcgcggggcggggctgccccgcccttg
gctccgcctccgccccgtccccgcacacctggcccgcagggcttgaagaaccacggcaac
acctgtttcatgaacgcggtggtgcagtgtctcagcaacaccgacctgctggccgagttc
ctggcgctggggcgctaccaggcggcgccgggccgcgccgaggtcaccgagcagctggcg
gcgctggtgcgcgcgctctggactcgcgaatacacgccccaactttccgcggagttcaag
aatgcagtttccaagtacggctctcagttccaaggcaattcccagcacgacgccctggaa
ttcctgctctggttgctggatcgtgtacatgaggacctggagggttcatcccgagggcca
gtgtcggagaagcttccgcctgaagccactaaaacctctgagaactgcctgtcaccatca
gctcagcttcctctaggtcaaagctttgtgcaaagccactttcaagcacaatatagatct
tccttgacttgtccccactgcctgaaacagagcaacacctttgatcctttcctgtgtgtg
tccctacctatccccttgcgccagacgaggttcttgagtgtcaccttggtcttcccctct
aagagccagcggttcctgcgggttggcttggccgtgcctatcctcagcacagtggcagcc
ctgaggaagatggttgcagaggaaggaggcgtccctgcagatgaggtgatcttggttgaa
ctgtatcccagtggattccagcggtctttctttgatgaagaggacctgaataccatcgca
gagggagataatgtgtatgcctttcaagttcctccctcacccagccaggggactctctca
gctcatccactgggtctgtcggcctccccacgcctggcagcccgtgagggccagcgattc
tccctctctctccacagtgagagcaaggtgctaatcctcttctgtaacttggtggggtca
gggcagcaggctagcaggtttgggccacccttcctgataagggaagacagagctgtttcc
tgggcccagctccagcagtctatcctcagcaaggtccgccatcttatgaagagtgaggcc
cctgtacagaacctggggtctctgttctccatccgtgttgtgggactctctgtggcctgc
agctatttgtctccaaaggacagtcggcccctctgtcactgggcagttgacagggttttg
catctcaggaggccaggaggccctccacatgtcaagctggcggtggagtgggatagctct
gtcaaggagcgcctgttcgggagcctccaggaggagcgagcgcaggatgccgacagtgtg
tggcagcagcagcaggcgcatcagcagcacagctgtaccttggatgaatgttttcagttc
tacaccaaggaggagcagctggcccaggatgacgcctggaagtgtcctcactgccaagtc
ctgcagcaggggatggtgaagctgagtttgtggacgctgcctgacatcctcatcatccac
ctcaaaaggttctgccaggtgggcgagagaagaaacaagctctccacgctggtgaagttt
ccgctctctggactcaacatggctccccatgtggcccagagaagcaccagccccgaggca
ggactgggcccctggccttcctggaagcagccggactgcctgcccaccagttacccgctg
gacttcctgtacgacctgtatgccgtctgcaaccaccacggcaacctgcaaggtgggcat
tacacagcctactgccggaactctctggatggccagtggtacagttatgatgacagcacg
gtggaaccgcttcgagaggatgaggtcaacaccagaggggcttatatcctgttctatcag
aagcggaacagcatccctccctggtcagccagcagctccatgagaggctctaccagctcc
tccctgtctgatcactggctcctacggctcgggagccacgctggcagcacaaggggaagc
ctgctgtcctggagctctgccccctgcccctccctgccccaggttcctgactctcccatc
ttcaccaacagtctctgcaatcaggaaaagggagggttggagtccaggcgtttggtacgg
ggcgtgaaaggcagaagcattagcatgaaggcacccaccacttcccgagccaagcaggga
ccattcaagaccatgcctctgaggtggtcctttggatccaaggagaaaccaccaggtgcc
tccgtcgagttggtggagtacttggaatccagacgaagacctcggtccacgagccagtcc
attgtgtcgctgttgacgggcactgcgggtgaggatgagaagtcagcatcgccgaggtcc
aacgtcgcccttcttgctaacagcgaagatggtgggcaggccattgaaagaggtccagcc
ggggtgccctgtccctcggctcaacccaaccactgtctggcccctggaaactcagatggt
ccaaacacagcaaggaaactcaaggaaaatgcagggcaggacatcaagcttcccagaaag
tttgacctgcctctcactgtgatgccttcagtggagcatgagaaaccagctcgaccggag
ggccagaaggccatgaactggaaggagagcttccagatgggaagcaaaagcagcccaccc
tccccctatatgggattctctggaaacagcaaagacagtcgccgaggcacctctgagcta
gacagacccctgcaggggacactcacccttctgaggtccgtgtttcggaagaaggagaac
aggaggaatgagagggcagaggtctctccacaggtgccccccgtctccctggtgagtggc
gggctgagccctgccatggtcgggcaggctccaggctcacctcctgccctcaggatccca
gagggcctggccaggggcctgggcagccggctcgagagggatgtttggtcagcccccagc
tctctccgcctccctcgtaaagccagcagggccccgagaggcagtgcactgggcatgtca
caaaggactgttccaggggagcaggcttcttatggcacctttcagagggtcaaatatcac
actctttctttaggtcgaaagaaaaccttaccggagtccagcttttga

DBGET integrated database retrieval system